Tested Applications
| Positive WB detected in | HeLa cells, human brain tissue, human lung tissue | 
| Positive IP detected in | mouse heart tissue | 
| Positive IF/ICC detected in | HepG2 cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 | 
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below | 
| WB | See 7 publications below | 
| FC | See 1 publications below | 
Product Information
12096-1-AP targets DNAJC19 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Cited Reactivity | human, mouse | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag2739 Product name: Recombinant human DNAJC19 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-116 aa of BC009702 Sequence: MASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK Predict reactive species | 
                                    
| Full Name | DnaJ (Hsp40) homolog, subfamily C, member 19 | 
| Calculated Molecular Weight | 116 aa, 13 kDa | 
| Observed Molecular Weight | 13 kDa | 
| GenBank Accession Number | BC009702 | 
| Gene Symbol | DNAJC19 | 
| Gene ID (NCBI) | 131118 | 
| RRID | AB_2094914 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q96DA6 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Background Information
DNAJC19 is a mitochondrial cochaperone that interacts with HSP70 chaperones through its conserved J-domain. As a transmembrane protein, DNAJC19 is strongly associated with the inner mitochondrial membrane. Mutations in DNAJC19 cause dilated cardiomyopathy with ataxia (DCMA). Recently DNAJC19 has been reported as interactor of PHB complex to regulate cardiolipin remodeling, which addressed the link of DNAJC19 to cardiomyopathy. This antibody is specific to DNAJC19 and had been tested by siRNA.(24856930)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for DNAJC19 antibody 12096-1-AP | Download protocol | 
| IP protocol for DNAJC19 antibody 12096-1-AP | Download protocol | 
| WB protocol for DNAJC19 antibody 12096-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
Nat Cell Biol PARL mediates Smac proteolytic maturation in mitochondria to promote apoptosis. | ||
Cell Metab DNAJC19, a mitochondrial cochaperone associated with cardiomyopathy, forms a complex with prohibitins to regulate cardiolipin remodeling.
  | ||
J Cell Biol OMA1 protease eliminates arrested protein import intermediates upon mitochondrial depolarization | ||
Stem Cell Res Generation of two patient-derived iPSC lines from siblings (LIBUCi001-A and LIBUCi002-A) and a genetically modified iPSC line (JMUi001-A-1) to mimic dilated cardiomyopathy with ataxia (DCMA) caused by a homozygous DNAJC19 mutation. | ||
Cell Rep The mitochondrial carrier SFXN1 is critical for complex III integrity and cellular metabolism. | 











