DRD1 Polyclonal antibody, PBS Only

• 

  WB analysis using 17934-1-AP (same clone as 17934-1-PBS)

  Mouse brain lysates were subjected to SDS PAGE followed by western blot with 17934-1-AP (DRD1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17934-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 17934-1-AP (same clone as 17934-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed frozen OCT-embedded mouse brain tissue using DRD1 antibody (17934-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 17934-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

DRD1 Polyclonal Antibody for WB, IF-Fro, ELISA

Cat No. 17934-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF-Fro, ELISA

Synonyms

D(1A) dopamine receptor, DADR, Dopamine D1 receptor, dopamine receptor D1

---

Product Information

17934-1-PBS targets DRD1 in WB, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12366

  Product name: Recombinant human DRD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 338-446 aa of BC074978

  Sequence: RKAFSTLLGCYRLCPATNNAIETVSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPALSVILDYDTDVSLEKIQPITQNGQHPT

• Full Name: dopamine receptor D1
• Calculated Molecular Weight: 446 aa, 49 kDa
• Observed Molecular Weight: 50-75 kDa
• GenBank Accession Number: BC074978
• Gene Symbol: DRD1
• Gene ID (NCBI): 1812
• RRID: AB_10598308
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P21728
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Dopamine is a neurotransmitter that plays a crucial role in physical and mental health, such as cardiovascular, hormonal, renal, and central nervous systems (PMID: 29220802). Five subtypes of mammalian dopamine receptors are grouped into two classes, the D1- and D2-like classes. The D1-like class includes D1 and D5 receptors whereas the D2-like class includes D2, D3, D4 subtypes (PMID: 9457173). Dopamine receptor D1 (DRD1) is the most abundant form of dopamine receptor in the central nervous system. DRD1 stimulates adenylate cyclase, modulates D2 receptor activity, regulates neuron growth and differentiation, and mediates several behavioral responses (PMID: 1977312). DRD1 has a calculated molecular weight of 49 kDa, larger apparent molecular weight of 60-80 kDa may be due to glycosylation (PMID: 1281547; 23821371).