Tested Applications
Positive WB detected in | U-937 cells, HeLa cells |
Positive IHC detected in | human ovary tumor tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
11687-1-AP targets DYNLT3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag2299 Product name: Recombinant human DYNLT3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-116 aa of BC000968 Sequence: MEEYHRHCDEVGFNAEEAHNIVKECVDGVLGGEDYNHNNINQWTASIVEQSLTHLVKLGKAYKYIVTCAVVQKSAYGFHTASSCFWDTTSDGTCTVRWENRTMNCIVNVFAIAIVL Predict reactive species |
Full Name | dynein, light chain, Tctex-type 3 |
Calculated Molecular Weight | 116 aa, 13 kDa |
Observed Molecular Weight | 13 kDa |
GenBank Accession Number | BC000968 |
Gene Symbol | DYNLT3 |
Gene ID (NCBI) | 6990 |
RRID | AB_2093777 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P51808 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Dynein light chain Tctex-type 3 (DYNLT3) is a member of the cytoplasmic dynamic protein light chain Tctex family. DYNLT3 mainly plays a regulatory role in mitosis and meiosis, as well as chromosome binding. DYNLT3 is expressed in all cells and tissues. The calculated molecular weight of DYNLT3 is 13 kDa.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for DYNLT3 antibody 11687-1-AP | Download protocol |
IHC protocol for DYNLT3 antibody 11687-1-AP | Download protocol |
IF protocol for DYNLT3 antibody 11687-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |