Tested Applications
Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
CL488-11687 targets DYNLT3 in IF/ICC applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag2299 Product name: Recombinant human DYNLT3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-116 aa of BC000968 Sequence: MEEYHRHCDEVGFNAEEAHNIVKECVDGVLGGEDYNHNNINQWTASIVEQSLTHLVKLGKAYKYIVTCAVVQKSAYGFHTASSCFWDTTSDGTCTVRWENRTMNCIVNVFAIAIVL Predict reactive species |
Full Name | dynein, light chain, Tctex-type 3 |
Calculated Molecular Weight | 116 aa, 13 kDa |
Observed Molecular Weight | 13 kDa |
GenBank Accession Number | BC000968 |
Gene Symbol | DYNLT3 |
Gene ID (NCBI) | 6990 |
RRID | AB_3672506 |
Conjugate | CoraLite® Plus 488 Fluorescent Dye |
Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P51808 |
Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Dynein light chain Tctex-type 3 (DYNLT3) is a member of the cytoplasmic dynamic protein light chain Tctex family. DYNLT3 mainly plays a regulatory role in mitosis and meiosis, as well as chromosome binding. DYNLT3 is expressed in all cells and tissues. The calculated molecular weight of DYNLT3 is 13 kDa.
Protocols
Product Specific Protocols | |
---|---|
IF protocol for CL Plus 488 DYNLT3 antibody CL488-11687 | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |