Tested Applications
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-11687 targets DYNLT3 in IF/ICC applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2299 Product name: Recombinant human DYNLT3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-116 aa of BC000968 Sequence: MEEYHRHCDEVGFNAEEAHNIVKECVDGVLGGEDYNHNNINQWTASIVEQSLTHLVKLGKAYKYIVTCAVVQKSAYGFHTASSCFWDTTSDGTCTVRWENRTMNCIVNVFAIAIVL Predict reactive species |
| Full Name | dynein, light chain, Tctex-type 3 |
| Calculated Molecular Weight | 116 aa, 13 kDa |
| Observed Molecular Weight | 13 kDa |
| GenBank Accession Number | BC000968 |
| Gene Symbol | DYNLT3 |
| Gene ID (NCBI) | 6990 |
| RRID | AB_3672506 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Excitation Laser | Blue laser (488 nm) |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P51808 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Dynein light chain Tctex-type 3 (DYNLT3) is a member of the cytoplasmic dynamic protein light chain Tctex family. DYNLT3 mainly plays a regulatory role in mitosis and meiosis, as well as chromosome binding. DYNLT3 is expressed in all cells and tissues. The calculated molecular weight of DYNLT3 is 13 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL Plus 488 DYNLT3 antibody CL488-11687 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

