Tested Applications
| Positive WB detected in | rat brain tissue, rat cerebellum tissue, mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
| IF | See 1 publications below |
Product Information
67083-1-Ig targets EAAT2 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | mouse |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19816 Product name: Recombinant human SLC1A2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 460-574 aa of BC132768 Sequence: PTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEMTKTQSIYDDMKNHRESNSNQCVYAAHNSVIVDECKVTLAANGKSADCSVEEEPWKREK Predict reactive species |
| Full Name | solute carrier family 1 (glial high affinity glutamate transporter), member 2 |
| Calculated Molecular Weight | 574 aa, 62 kDa |
| Observed Molecular Weight | 60-70 kDa |
| GenBank Accession Number | BC132768 |
| Gene Symbol | EAAT2 |
| Gene ID (NCBI) | 6506 |
| RRID | AB_2882391 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P43004 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
EAAT2 (also known as GLT-1), is encoded by SLC1A2 and is a glutamate transporter which can clear the majority of extracellular glutamate in brain and prevent brain seizures.Three isoforms of EAAT2 exist due to the alternative splicing. In addition to the 65-70 kDa monomer form, 130-150 kDa dimer of EAAT2 can also be observed on SDS-PAGE.(PMID: 22114258)
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for EAAT2 antibody 67083-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Rep Med TwinF interface inhibitor FP802 stops loss of motor neurons and mitigates disease progression in a mouse model of ALS | ||
Neuron GPR37L1 identifies spinal cord astrocytes and protects neuropathic pain after nerve injury |

