Tested Applications
Positive WB detected in | rat brain tissue, rat cerebellum tissue, mouse brain tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:8000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
IF | See 1 publications below |
Product Information
67083-1-Ig targets EAAT2 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | mouse |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag19816 Product name: Recombinant human SLC1A2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 460-574 aa of BC132768 Sequence: PTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEMTKTQSIYDDMKNHRESNSNQCVYAAHNSVIVDECKVTLAANGKSADCSVEEEPWKREK Predict reactive species |
Full Name | solute carrier family 1 (glial high affinity glutamate transporter), member 2 |
Calculated Molecular Weight | 574 aa, 62 kDa |
Observed Molecular Weight | 60-70 kDa |
GenBank Accession Number | BC132768 |
Gene Symbol | EAAT2 |
Gene ID (NCBI) | 6506 |
RRID | AB_2882391 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | P43004 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
EAAT2 (also known as GLT-1), is encoded by SLC1A2 and is a glutamate transporter which can clear the majority of extracellular glutamate in brain and prevent brain seizures.Three isoforms of EAAT2 exist due to the alternative splicing. In addition to the 65-70 kDa monomer form, 130-150 kDa dimer of EAAT2 can also be observed on SDS-PAGE.(PMID: 22114258)
Protocols
Product Specific Protocols | |
---|---|
WB protocol for EAAT2 antibody 67083-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Rep Med TwinF interface inhibitor FP802 stops loss of motor neurons and mitigates disease progression in a mouse model of ALS | ||
Neuron GPR37L1 identifies spinal cord astrocytes and protects neuropathic pain after nerve injury |