EAAT2 Monoclonal antibody, PBS Only (Detector)

• 

  WB analysis using 67083-1-Ig (same clone as 67083-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67083-1-Ig (SLC1A2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67083-1-PBS in a different storage buffer formulation.

• 

  Sample test of MP51374-1

  Sample test of MP51374-1, SLC1A2 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67083-2-PBS. Detection antibody: 67083-1-PBS.

• 

  Cytometric bead array standard curve of MP51374-1

  Cytometric bead array standard curve of MP51374-1, SLC1A2 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67083-2-PBS. Detection antibody: 67083-1-PBS. Standard:Ag19816. Range: 0.098-100 ng/mL.

EAAT2 Monoclonal Antibody for WB, Cytometric bead array, Indirect ELISA, Sample test

Cat No. 67083-1-PBS

Clone No.1C8D10

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, Cytometric bead array, Indirect ELISA, Sample test

Synonyms

GLT1, SLC1A2, 1C8D10, GLT 1, Sodium-dependent glutamate/aspartate transporter 2

---

Product Information

67083-1-PBS targets EAAT2 as part of a matched antibody pair:

MP51374-1: 67083-2-PBS capture and 67083-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19816

  Product name: Recombinant human SLC1A2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 460-574 aa of BC132768

  Sequence: PTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEMTKTQSIYDDMKNHRESNSNQCVYAAHNSVIVDECKVTLAANGKSADCSVEEEPWKREK

• Full Name: solute carrier family 1 (glial high affinity glutamate transporter), member 2
• Calculated Molecular Weight: 574 aa, 62 kDa
• Observed Molecular Weight: 60-70 kDa
• GenBank Accession Number: BC132768
• Gene Symbol: EAAT2
• Gene ID (NCBI): 6506
• RRID: AB_2882391
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P43004
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

EAAT2 (also known as GLT-1), is encoded by SLC1A2 and is a glutamate transporter which can clear the majority of extracellular glutamate in brain and prevent brain seizures.Three isoforms of EAAT2 exist due to the alternative splicing. In addition to the 65-70 kDa monomer form, 130-150 kDa dimer of EAAT2 can also be observed on SDS-PAGE.(PMID: 22114258)