EAAT2 Monoclonal antibody, PBS Only (Detector)

EAAT2 Monoclonal Antibody for WB, Cytometric bead array, Indirect ELISA, Sample test
Cat No. 67083-1-PBS
Clone No.1C8D10

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, Cytometric bead array, Indirect ELISA, Sample test

GLT1, SLC1A2, 1C8D10, GLT 1, Sodium-dependent glutamate/aspartate transporter 2

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67083-1-PBS targets EAAT2 as part of a matched antibody pair:

MP51374-1: 67083-2-PBS capture and 67083-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag19816

Product name: Recombinant human SLC1A2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 460-574 aa of BC132768

Sequence: PTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEMTKTQSIYDDMKNHRESNSNQCVYAAHNSVIVDECKVTLAANGKSADCSVEEEPWKREK

Predict reactive species
Full Name solute carrier family 1 (glial high affinity glutamate transporter), member 2
Calculated Molecular Weight 574 aa, 62 kDa
Observed Molecular Weight 60-70 kDa
GenBank Accession NumberBC132768
Gene Symbol EAAT2
Gene ID (NCBI) 6506
RRIDAB_2882391
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP43004
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

EAAT2 (also known as GLT-1), is encoded by SLC1A2 and is a glutamate transporter which can clear the majority of extracellular glutamate in brain and prevent brain seizures.Three isoforms of EAAT2 exist due to the alternative splicing. In addition to the 65-70 kDa monomer form, 130-150 kDa dimer of EAAT2 can also be observed on SDS-PAGE.(PMID: 22114258)

Loading...
||
New chat Able
正在加载,请稍候...