ECSIT Polyclonal antibody, PBS Only

• 

  WB analysis using 27548-1-AP (same clone as 27548-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27548-1-AP (ECSIT antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27548-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 27548-1-AP (same clone as 27548-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27548-1-AP (ECSIT antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27548-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 27548-1-AP (same clone as 27548-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 27548-1-AP (ECSIT antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27548-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 27548-1-AP (same clone as 27548-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 27548-1-AP (ECSIT antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27548-1-PBS in a different storage buffer formulation.

ECSIT Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 27548-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

SITPEC, Protein SITPEC, ECSIT homolog (Drosophila)

---

Product Information

27548-1-PBS targets ECSIT in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26877

  Product name: Recombinant human ECSIT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 49-267 aa of BC008279

  Sequence: SSEQSLVPSPPEPRQRPTKALVPFEDLFGQAPGGERDKASFLQTVQKFAEHSVRKRGHIDFIYLALRKMREYGVERDLAVYNQLLNIFPKEVFRPRNIIQRIFVHYPRQQECGIAVLEQMENHGVMPNKETEFLLIQIFGRKSYPMLKLVRLKLWFPRFMNVNPFPVPRDLPQDPVELAMFGLRHMEPDLSARVTIYQVPLPKDSTGAADPPQPHIVGS

• Full Name: ECSIT homolog (Drosophila)
• Calculated Molecular Weight: 49 kDa
• Observed Molecular Weight: 49 kDa
• GenBank Accession Number: BC008279
• Gene Symbol: ECSIT
• Gene ID (NCBI): 51295
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BQ95
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ECSIT is a cytosolic adaptor protein associated with the toll-like receptor pathway. It has a distinct N-terminal mitochondrial targeting sequence, pentatricopeptide repeat motif, and a C-terminal pleckstrin homology domain. ECSIT regulates many biological processes like embryonic development, inflammation, cardiac function, and assembly of mitochondrial complex I. In macrophages, the activation of TLRs by inflammatory signals promotes the translocation of TRAF6 to mitochondria where it engages ECSIT to stimulate the production of mitochondrial reactive oxygen species (ROS).