EDEM1 Polyclonal antibody

• 

  WB analysis using 26226-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26226-1-AP (EDEM1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse liver using 26226-1-AP

  IP result of anti-EDEM1 (IP:26226-1-AP, 4ug; Detection:26226-1-AP 1:500) with mouse liver tissue lysate 4000ug.

• 

  IHC staining of human liver cancer using 26226-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 26226-1-AP (EDEM1 antibody) at dilution of 1:200 (under 0x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

EDEM1 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 26226-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

EDEM, EDEM1, KIAA0212

---

Tested Applications

• Positive WB detected in: HepG2 cells, L02 cells, mouse liver, rat liver
• Positive IP detected in: mouse liver tissue
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 5 publications below

Product Information

26226-1-AP targets EDEM1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24046

  Product name: Recombinant human EDEM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 564-657 aa of BC019088

  Sequence: EDNPVHKSGTRYMFTTEGHIVSVDEHLRELPWKEFFSEEGGQDQGGKSVHRPKPHELKVINSSSNCNRVPDERRYSLPLKSIYMRQIDQMVGLI

• Full Name: ER degradation enhancer, mannosidase alpha-like 1
• Calculated Molecular Weight: 74 kDa
• Observed Molecular Weight: 66-75 kDa
• GenBank Accession Number: BC019088
• Gene Symbol: EDEM1
• Gene ID (NCBI): 9695
• RRID: AB_2880433
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92611
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Oncogene; Small extracellular vesicles containing miR-30a-3p attenuate the migration and invasion of hepatocellular carcinoma by targeting SNAP23 gene.; Authors - Chengdong Liu
human	WB	Front Mol Biosci; Glutamate-Cysteine Ligase Catalytic Subunit Attenuated Hepatitis C Virus-Related Liver Fibrosis and Suppressed Endoplasmic Reticulum Stress.; Authors - Na Fu
human	WB	J Cell Biochem; Erdj3 has an essential role for Z variant Alpha-1-Antitrypsin Degradation.; Authors - Nazli Khodayari
mouse	WB	bioRxiv; A new role for IFRD1 in regulation of ER stress in bladder epithelial homeostasis; Authors - Bisiayo E Fashemi
mouse	WB	iScience; IFRD1 is required for maintenance of bladder epithelial homeostasis; Authors - Bisiayo E Fashemi