Tested Applications
Positive WB detected in | HepG2 cells, L02 cells, mouse liver, rat liver |
Positive IP detected in | mouse liver tissue |
Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 5 publications below |
Product Information
26226-1-AP targets EDEM1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24046 Product name: Recombinant human EDEM1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 564-657 aa of BC019088 Sequence: EDNPVHKSGTRYMFTTEGHIVSVDEHLRELPWKEFFSEEGGQDQGGKSVHRPKPHELKVINSSSNCNRVPDERRYSLPLKSIYMRQIDQMVGLI Predict reactive species |
Full Name | ER degradation enhancer, mannosidase alpha-like 1 |
Calculated Molecular Weight | 74 kDa |
Observed Molecular Weight | 66-75 kDa |
GenBank Accession Number | BC019088 |
Gene Symbol | EDEM1 |
Gene ID (NCBI) | 9695 |
RRID | AB_2880433 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q92611 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for EDEM1 antibody 26226-1-AP | Download protocol |
IHC protocol for EDEM1 antibody 26226-1-AP | Download protocol |
IP protocol for EDEM1 antibody 26226-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Oncogene Small extracellular vesicles containing miR-30a-3p attenuate the migration and invasion of hepatocellular carcinoma by targeting SNAP23 gene. | ||
Front Mol Biosci Glutamate-Cysteine Ligase Catalytic Subunit Attenuated Hepatitis C Virus-Related Liver Fibrosis and Suppressed Endoplasmic Reticulum Stress. | ||
J Cell Biochem Erdj3 has an essential role for Z variant Alpha-1-Antitrypsin Degradation. | ||
bioRxiv A new role for IFRD1 in regulation of ER stress in bladder epithelial homeostasis | ||