Tested Applications
| Positive WB detected in | HepG2 cells, L02 cells, mouse liver, rat liver |
| Positive IP detected in | mouse liver tissue |
| Positive IHC detected in | human liver cancer tissue, mouse stomach tissue, human appendicitis tissue, rat lung tissue, human rectal cancer tissue, rat stomach tissue, mouse lung tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26226-1-AP targets EDEM1 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, pig, hamster, sheep |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24046 Product name: Recombinant human EDEM1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 564-657 aa of BC019088 Sequence: EDNPVHKSGTRYMFTTEGHIVSVDEHLRELPWKEFFSEEGGQDQGGKSVHRPKPHELKVINSSSNCNRVPDERRYSLPLKSIYMRQIDQMVGLI Predict reactive species |
| Full Name | ER degradation enhancer, mannosidase alpha-like 1 |
| Calculated Molecular Weight | 74 kDa |
| Observed Molecular Weight | 66-75 kDa |
| GenBank Accession Number | BC019088 |
| Gene Symbol | EDEM1 |
| Gene ID (NCBI) | 9695 |
| RRID | AB_2880433 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q92611 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for EDEM1 antibody 26226-1-AP | Download protocol |
| IP protocol for EDEM1 antibody 26226-1-AP | Download protocol |
| WB protocol for EDEM1 antibody 26226-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The EDEM1 antibody (Cat# 26226-1-AP) has 10 total citations across journals including Research, Oncogene, Cell Biosciences, PLoS Pathogens, iScience, Frontiers in Molecular Biosciences, Journal of Virology, and Journal of Cellular Biochemistry. Research fields span endoplasmic reticulum stress, cancer (triple-negative breast cancer, hepatocellular carcinoma), virology (Japanese encephalitis virus, bluetongue virus, hepatitis C, PRRSV), bladder epithelial homeostasis, osteoarthritis, and protein degradation pathways.
| Species | Application | Title |
|---|---|---|
Research (Wash D C) EDEM1 Inhibits Endoplasmic Reticulum Stress to Induce Doxorubicin Resistance through Accelerating ERAD and Activating Keap1/Nrf2 Antioxidant Pathway in Triple-Negative Breast Cancer | ||
Oncogene Small extracellular vesicles containing miR-30a-3p attenuate the migration and invasion of hepatocellular carcinoma by targeting SNAP23 gene. | ||
Cell Biosci CALR-dependent endoplasmic reticulum N-glycoprotein maturation promotes Japanese encephalitis virus entry and replication. | ||
Pharm Biol lncRNA MALAT1-mediated regulation of cholesterol-oxidative stress-iron metabolic dysregulation by paeoniflorin in osteoarthritic chondrocytes. | ||
PLoS Pathog Insect-borne non-enveloped bluetongue virus utilizes discrete small vesicles for non-lytic release and cell-to-cell transmission. | ||
