EGFR Monoclonal antibody

EGFR Monoclonal Antibody for WB, IF/ICC, FC, ELISA, Blocking

Cat No. 68643-1-Ig
Clone No.2C8C12

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IF/ICC, FC, ELISA, Blocking

Proto-oncogene c-ErbB-1, Epidermal growth factor receptor, EGF Receptor , EGF R, 2C8C12

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inSCaBER cells, HaCaT cells, MDA-MB-468 cells, A431 cells
Positive IF/ICC detected inHaCaT cells, A431 cells
Positive FC detected inA431 cells
Positive Blocking detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunofluorescence (IF)/ICCIF/ICC : 1:500-1:2000
Flow Cytometry (FC)FC : 0.20 ug per 10^6 cells in a 100 µl suspension
BLOCKINGBLOCKING : 1:10-1:100
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68643-1-Ig targets EGFR in WB, IF/ICC, FC, ELISA, Blocking applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag24947

Product name: Recombinant human EGFR protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 291-534 aa of BC094761

Sequence: VCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNC

Predict reactive species
Full Name epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian)
Calculated Molecular Weight134kd
Observed Molecular Weight160 kDa
GenBank Accession NumberNM_005228.5
Gene Symbol EGFR
Gene ID (NCBI) 1956
RRIDAB_3670387
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP00533
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EGFR, also named ERBB1, is a cell-surface receptor for members of the epidermal growth factor family (EGF-family) of extracellular protein ligands. Binding of the protein to a ligand induces receptor dimerization and tyrosine autophosphorylation and leads to cell proliferation. The gene resides on chromosome 7p12, encoding a 170 kDa membrane-associated glycoprotein. Recent studies have shown EGFR plays a critical role in cancer development and progression, including cell proliferation, apoptosis, angiogenesis, and metastatic spread. Mutations in this gene are associated with lung cancer. When stained with live cells, EGFR can be transported into the cell interior, which is consistent with the literature report (PMID: 18084617).

Protocols

Product Specific Protocols
FC protocol for EGFR antibody 68643-1-IgDownload protocol
IF protocol for EGFR antibody 68643-1-IgDownload protocol
WB protocol for EGFR antibody 68643-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...