EGFR Monoclonal antibody, PBS Only (Capture)

EGFR Monoclonal Antibody for WB, IF/ICC, FC, Sandwich ELISA, Indirect ELISA, Blocking, Sample test

Cat No. 68643-1-PBS
Clone No.2C8C12

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IF/ICC, FC, Sandwich ELISA, Indirect ELISA, Blocking, Sample test

2C8C12, EGF R, EGF Receptor , Epidermal growth factor receptor, Proto-oncogene c-ErbB-1

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68643-1-PBS targets EGFR as part of a matched antibody pair:

MP50069-1: 68643-1-PBS capture and 68643-2-PBS detection (validated in Sandwich ELISA)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag24947

Product name: Recombinant human EGFR protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 291-534 aa of BC094761

Sequence: VCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNC

Predict reactive species
Full Name epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian)
Calculated Molecular Weight134kd
Observed Molecular Weight160 kDa
GenBank Accession NumberNM_005228.5
Gene Symbol EGFR
Gene ID (NCBI) 1956
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP00533
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

EGFR, also named ERBB1, is a cell-surface receptor for members of the epidermal growth factor family (EGF-family) of extracellular protein ligands. Binding of the protein to a ligand induces receptor dimerization and tyrosine autophosphorylation and leads to cell proliferation. The gene resides on chromosome 7p12, encoding a 170 kDa membrane-associated glycoprotein. Recent studies have shown EGFR plays a critical role in cancer development and progression, including cell proliferation, apoptosis, angiogenesis, and metastatic spread. Mutations in this gene are associated with lung cancer. When stained with live cells, EGFR can be transported into the cell interior, which is consistent with the literature report (PMID: 18084617).

Loading...
||
New chat Able
正在加载,请稍候...