EGLN3 Recombinant monoclonal antibody, PBS Only (Capture)

EGLN3 Uni-rAb® Recombinant Antibody for IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA
Cat No. 83321-1-PBS
Clone No.240165A6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

PHD3, 240165A6, EC:1.14.11.-, EC:1.14.11.29, Egl nine homolog 3

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83321-1-PBS targets EGLN3 as part of a matched antibody pair:

MP00347-1: 83321-1-PBS capture and 83321-4-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag27464

Product name: Recombinant human EGLN3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-115 aa of BC010992

Sequence: MPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHCTGALRDGQLAGPRAGVSKRHLRGDQITWIGGNEEGCEAISFLLSLIDRLVLYCGSRLGKYYVK

Predict reactive species
Full Name egl nine homolog 3 (C. elegans)
Calculated Molecular Weight 27 kDa
Observed Molecular Weight27 kDa
GenBank Accession NumberBC010992
Gene Symbol EGLN3
Gene ID (NCBI) 112399
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9H6Z9
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

EGLN3, also named as HPH-1, HIF-PH3, HPH-3 and PHD3, is a cellular oxygen sensor that catalyzes, under normoxic conditions, the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. It hydroxylates a specific proline found in each of the oxygen-dependent degradation (ODD) domains (N-terminal, NODD, and C-terminal, CODD) of HIF1A. It is a regulator of cardiomyocyte and neuronal apoptosis. EGLN3 can be a prognostic marker for gastric cancer.

Loading...
||
New chat Able
正在加载,请稍候...