EGLN3 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  IF Staining of HepG2 using 83321-1-RR (same clone as 83321-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using EGLN3 antibody (83321-1-RR, Clone: 240165A6 ) at dilution of 1:250 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 83321-1-PBS in a different storage buffer formulation.

• 

  FC experiment of MCF-7 using 83321-1-RR (same clone as 83321-1-PBS)

  1x10^6 MCF-7 cells were intracellularly stained with 0.25 ug Egln3 Recombinant Antibody (83321-1-RR, Clone:240165A6) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83321-1-PBS in a different storage buffer formulation.

• 

  FC experiment of A549 using 83321-1-RR (same clone as 83321-1-PBS)

  1x10^6 A549 cells were intracellularly stained with 0.25 ug Egln3 Recombinant Antibody (83321-1-RR, Clone:240165A6) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83321-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP00347-1

  Cytometric bead array standard curve of MP00347-1, EGLN3 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 83321-1-PBS. Detection antibody: 83321-4-PBS. Standard: Ag27464. Range: 0.313-40 ng/mL.

• 

  Affinity and Kinetic Characterization of 83321-1-PBS

  Biolayer interferometry (BLl) kinetic assay of 83321-1-PBS against Human EGLN3 was performed. The affinity constant is 4.82 nM.

• 

  Affinity and Kinetic Characterization of 83321-1-RR

  Biolayer interferometry (BLl) kinetic assays of 83321-1-RR against Human EGLN3 were performed. The affinity constant is 1.82 nM.

EGLN3 Uni-rAb^® Recombinant Antibody for IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

Cat No. 83321-1-PBS

Clone No.240165A6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

Synonyms

PHD3, 240165A6, EC:1.14.11.-, EC:1.14.11.29, Egl nine homolog 3

---

Product Information

83321-1-PBS targets EGLN3 as part of a matched antibody pair:

MP00347-1: 83321-1-PBS capture and 83321-4-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag27464

  Product name: Recombinant human EGLN3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-115 aa of BC010992

  Sequence: MPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHCTGALRDGQLAGPRAGVSKRHLRGDQITWIGGNEEGCEAISFLLSLIDRLVLYCGSRLGKYYVK

• Full Name: egl nine homolog 3 (C. elegans)
• Calculated Molecular Weight: 27 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC010992
• Gene Symbol: EGLN3
• Gene ID (NCBI): 112399
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9H6Z9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

EGLN3, also named as HPH-1, HIF-PH3, HPH-3 and PHD3, is a cellular oxygen sensor that catalyzes, under normoxic conditions, the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. It hydroxylates a specific proline found in each of the oxygen-dependent degradation (ODD) domains (N-terminal, NODD, and C-terminal, CODD) of HIF1A. It is a regulator of cardiomyocyte and neuronal apoptosis. EGLN3 can be a prognostic marker for gastric cancer.