Tested Applications
Positive IF/ICC detected in | HepG2 cells |
Positive FC (Intra) detected in | A549 cells, MCF-7 cells |
Recommended dilution
Application | Dilution |
---|---|
Immunofluorescence (IF)/ICC | IF/ICC : 1:125-1:500 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
83321-1-RR targets EGLN3 in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag27464 Product name: Recombinant human EGLN3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-115 aa of BC010992 Sequence: MPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHCTGALRDGQLAGPRAGVSKRHLRGDQITWIGGNEEGCEAISFLLSLIDRLVLYCGSRLGKYYVK Predict reactive species |
Full Name | egl nine homolog 3 (C. elegans) |
Calculated Molecular Weight | 27 kDa |
Observed Molecular Weight | 27 kDa |
GenBank Accession Number | BC010992 |
Gene Symbol | EGLN3 |
Gene ID (NCBI) | 112399 |
RRID | AB_3670987 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q9H6Z9 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
EGLN3, also named as HPH-1, HIF-PH3, HPH-3 and PHD3, is a cellular oxygen sensor that catalyzes, under normoxic conditions, the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. It hydroxylates a specific proline found in each of the oxygen-dependent degradation (ODD) domains (N-terminal, NODD, and C-terminal, CODD) of HIF1A. It is a regulator of cardiomyocyte and neuronal apoptosis. EGLN3 can be a prognostic marker for gastric cancer.
Protocols
Product Specific Protocols | |
---|---|
IF protocol for EGLN3 antibody 83321-1-RR | Download protocol |
FC protocol for EGLN3 antibody 83321-1-RR | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |