EHHADH Recombinant monoclonal antibody

• 

  WB analysis using 87579-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87579-1-RR (EHHADH antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human kidney using 87579-1-RR

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 87579-1-RR (EHHADH antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 87579-1-RR

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 87579-1-RR (EHHADH antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

EHHADH Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 87579-1-RR

Clone No.252944F5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

3-hydroxyacyl-CoA dehydrogenase, ECHD, Enoyl-CoA hydratase/3,2-trans-enoyl-CoA isomerase, L PBE, LBFP

---

Tested Applications

• Positive WB detected in: mouse kidney tissue, rat kidney tissue, mouse liver tissue, rat liver tissue
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87579-1-RR targets EHHADH in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag24237

  Product name: Recombinant human EHHADH protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 108-284 aa of BC038948

  Sequence: GCHYRIAHAEAQVGLPEVTLGLLPGARGTQLLPRLTGVPAALDLITSGRRILADEALKLGILDKVVNSDPVEEAIRFAQRVSDQPLESRRLCNKPIQSLPNMDSIFSEALLKMRRQHPGCLAQEACVRAVQAAVQYPYEVGIKKEEELFLYLLQSGQARALQYAFFAERKANKWSTP

• Full Name: enoyl-Coenzyme A, hydratase/3-hydroxyacyl Coenzyme A dehydrogenase
• Calculated Molecular Weight: 723 aa, 79 kDa
• Observed Molecular Weight: 69 kDa
• GenBank Accession Number: BC038948
• Gene Symbol: EHHADH
• Gene ID (NCBI): 1962
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q08426
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EHHADH, as the "bifunctional catalytic center" of peroxisome fatty acid β-oxidation, its expression and activity directly affect energy metabolism, inflammation level and cell fate. Gene defect causes serious neuro-renal tubular lesions, and abnormal expression is closely related to modern chronic diseases such as obesity, diabetes and tumor, which is one of the hot metabolic enzymes concerned by basic research and clinical transformation. It is mainly located in peroxisome, and some activity can be detected in mitochondrial inner membrane, and it is highly expressed in liver, kidney, heart and other organs.