EHHADH Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 87579-1-RR (same clone as 87579-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87579-1-RR (EHHADH antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87579-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 87579-1-RR (same clone as 87579-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 87579-1-RR (EHHADH antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 87579-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 87579-1-RR (same clone as 87579-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 87579-1-RR (EHHADH antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 87579-1-PBS in a different storage buffer formulation.

EHHADH Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 87579-1-PBS

Clone No.252944F5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

3-hydroxyacyl-CoA dehydrogenase, ECHD, Enoyl-CoA hydratase/3,2-trans-enoyl-CoA isomerase, L PBE, LBFP

---

Product Information

87579-1-PBS targets EHHADH in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag24237

  Product name: Recombinant human EHHADH protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 108-284 aa of BC038948

  Sequence: GCHYRIAHAEAQVGLPEVTLGLLPGARGTQLLPRLTGVPAALDLITSGRRILADEALKLGILDKVVNSDPVEEAIRFAQRVSDQPLESRRLCNKPIQSLPNMDSIFSEALLKMRRQHPGCLAQEACVRAVQAAVQYPYEVGIKKEEELFLYLLQSGQARALQYAFFAERKANKWSTP

• Full Name: enoyl-Coenzyme A, hydratase/3-hydroxyacyl Coenzyme A dehydrogenase
• Calculated Molecular Weight: 723 aa, 79 kDa
• Observed Molecular Weight: 69 kDa
• GenBank Accession Number: BC038948
• Gene Symbol: EHHADH
• Gene ID (NCBI): 1962
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q08426
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

EHHADH, as the "bifunctional catalytic center" of peroxisome fatty acid β-oxidation, its expression and activity directly affect energy metabolism, inflammation level and cell fate. Gene defect causes serious neuro-renal tubular lesions, and abnormal expression is closely related to modern chronic diseases such as obesity, diabetes and tumor, which is one of the hot metabolic enzymes concerned by basic research and clinical transformation. It is mainly located in peroxisome, and some activity can be detected in mitochondrial inner membrane, and it is highly expressed in liver, kidney, heart and other organs.