EIF1 Monoclonal antibody

• 

  WB analysis of HEK-293 using 67601-1-Ig

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 67601-1-Ig (EIF1 antibody) at dilution of 1:3200 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 67601-1-Ig

  Jurkat cells were subjected to SDS PAGE followed by western blot with 67601-1-Ig (EIF1 antibody) at dilution of 1:3200 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HepG2 using 67601-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using 67601-1-Ig (EIF1 antibody), at dilution of 1:300 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

• 

  IF Staining of HepG2 using 67601-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using EIF1 antibody (67601-1-Ig, Clone: 2G8C6 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

EIF1 Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 67601-1-Ig

Clone No.2G8C6

Host / Isotype

Mouse / IgG2b

Reactivity

Human

Applications

WB, IF/ICC, ELISA

Synonyms

A121, EIF 1, EIF1, EIF1A, ISO1, SUI1, Sui1iso1

---

Tested Applications

• Positive WB detected in: HEK-293 cells, Jurkat cells
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6400
• Immunofluorescence (IF)/ICC: IF/ICC : 1:150-1:600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67601-1-Ig targets EIF1 in WB, IF/ICC, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7843

  Product name: Recombinant human EIF1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-113 aa of BC005118

  Sequence: MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF

• Full Name: eukaryotic translation initiation factor 1
• Calculated Molecular Weight: 13 kDa
• Observed Molecular Weight: 13 kDa
• GenBank Accession Number: BC005118
• Gene Symbol: EIF1
• Gene ID (NCBI): 10209
• RRID: AB_2882807
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P41567
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

It is a necessary for scanning and involved in initiation site selection. Promotes the assembly of 48S ribosomal complexes at the authentic initiation codon of a conventional capped mRNA. Molecular weight is 13kd.