Tested Applications
Positive WB detected in | HEK-293 cells, Jurkat cells |
Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:6400 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:150-1:600 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
67601-1-Ig targets EIF1 in WB, IF/ICC, ELISA applications and shows reactivity with Human samples.
Tested Reactivity | Human |
Host / Isotype | Mouse / IgG2b |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag7843 Product name: Recombinant human EIF1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-113 aa of BC005118 Sequence: MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF Predict reactive species |
Full Name | eukaryotic translation initiation factor 1 |
Calculated Molecular Weight | 13 kDa |
Observed Molecular Weight | 13 kDa |
GenBank Accession Number | BC005118 |
Gene Symbol | EIF1 |
Gene ID (NCBI) | 10209 |
RRID | AB_2882807 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P41567 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
It is a necessary for scanning and involved in initiation site selection. Promotes the assembly of 48S ribosomal complexes at the authentic initiation codon of a conventional capped mRNA. Molecular weight is 13kd.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for EIF1 antibody 67601-1-Ig | Download protocol |
IF protocol for EIF1 antibody 67601-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |