Product Information
67601-1-PBS targets EIF1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with Human samples.
Tested Reactivity | Human |
Host / Isotype | Mouse / IgG2b |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag7843 Product name: Recombinant human EIF1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-113 aa of BC005118 Sequence: MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF Predict reactive species |
Full Name | eukaryotic translation initiation factor 1 |
Calculated Molecular Weight | 13 kDa |
Observed Molecular Weight | 13 kDa |
GenBank Accession Number | BC005118 |
Gene Symbol | EIF1 |
Gene ID (NCBI) | 10209 |
RRID | AB_2882807 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P41567 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
It is a necessary for scanning and involved in initiation site selection. Promotes the assembly of 48S ribosomal complexes at the authentic initiation codon of a conventional capped mRNA. Molecular weight is 13kd.