EIF4E Monoclonal antibody, PBS Only

• 

  WB analysis using 66655-1-Ig (same clone as 66655-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66655-1-Ig (EIF4E antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 66655-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 66655-1-Ig (same clone as 66655-1-PBS)

  WB result of EIF4E antibody (66655-1-Ig; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-EIF4E transfected HEK-293 cells. This data was developed using the same antibody clone with 66655-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66655-1-Ig (same clone as 66655-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66655-1-Ig (EIF4E antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 66655-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66655-1-Ig (same clone as 66655-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66655-1-Ig (EIF4E antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66655-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 66655-1-Ig (same clone as 66655-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66655-1-Ig (EIF4E antibody) at dilution of 1:5000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66655-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 66655-1-Ig (same clone as 66655-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66655-1-Ig (EIF4E antibody) at dilution of 1:5000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66655-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 66655-1-Ig (same clone as 66655-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using EIF4E antibody (66655-1-Ig, Clone: 3C6B9 ) at dilution of 1:800 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002). This data was developed using the same antibody clone with 66655-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 66655-1-Ig (same clone as 66655-1-PBS)

  1X10^6 HepG2 cells were intracellularly stained with 0.2 ug Anti-Human EIF4E (66655-1-Ig, Clone:3C6B9) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.2 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 66655-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

EIF4E Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 66655-1-PBS

Clone No.3C6B9

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

3C6B9, eIF 4E, eIF-4E, EIF4EL1, EIF4F

---

Product Information

66655-1-PBS targets EIF4E in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27191

  Product name: Recombinant human EIF4E protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-217 aa of BC012611

  Sequence: MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLNRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV

• Full Name: eukaryotic translation initiation factor 4E
• Calculated Molecular Weight: 29 kDa
• Observed Molecular Weight: 26-29 kDa
• GenBank Accession Number: BC012611
• Gene Symbol: EIF4E
• Gene ID (NCBI): 1977
• RRID: AB_2882012
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P06730
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Eukaryotic translation initiation factor 4E, also known as eIF4E, is a protein that in humans is encoded by the EIF4E gene. eIF4E is the mRNA cap-binding protein, known as a general initiation factor allowing for mRNA-ribosome interaction and cap-dependent translation in eukaryotic cells. eIF4E is a polypeptide that exists as both a free form and as part of the eIF4F pre-initiation complex. Regulation of eIF4E may be achieved via three distinct mechanisms: transcription, phosphorylation, and inhibitory proteins.