Tested Applications
| Positive WB detected in | Jurkat cells, HEK-293 cells, LNCaP cells, U2OS cells, HSC-T6 cells, NIH/3T3 cells, RAW 264.7 cells, HeLa cells, MCF-7 cells |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:2500-1:10000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66655-1-Ig targets EIF4E in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27191 Product name: Recombinant human EIF4E protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-217 aa of BC012611 Sequence: MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLNRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV Predict reactive species |
| Full Name | eukaryotic translation initiation factor 4E |
| Calculated Molecular Weight | 29 kDa |
| Observed Molecular Weight | 26-29 kDa |
| GenBank Accession Number | BC012611 |
| Gene Symbol | EIF4E |
| Gene ID (NCBI) | 1977 |
| RRID | AB_2882012 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P06730 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Eukaryotic translation initiation factor 4E, also known as eIF4E, is a protein that in humans is encoded by the EIF4E gene. eIF4E is the mRNA cap-binding protein, known as a general initiation factor allowing for mRNA-ribosome interaction and cap-dependent translation in eukaryotic cells. eIF4E is a polypeptide that exists as both a free form and as part of the eIF4F pre-initiation complex. Regulation of eIF4E may be achieved via three distinct mechanisms: transcription, phosphorylation, and inhibitory proteins.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for EIF4E antibody 66655-1-Ig | Download protocol |
| IF protocol for EIF4E antibody 66655-1-Ig | Download protocol |
| IHC protocol for EIF4E antibody 66655-1-Ig | Download protocol |
| WB protocol for EIF4E antibody 66655-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The EIF4E Monoclonal antibody (3C6B9), catalog number 66655-1-Ig, has 12 citations published in journals including Nature Communications, Developmental Cell, Cell Death & Disease, Journal of Immunotherapy of Cancer, Metabolism, Journal of Cell Biology, Neuroscience Bulletin, International Journal of Molecular Sciences, Scientific Reports, PNAS Nexus, World Journal of Gastroenterology, and Research. Research fields span cancer biology, translational regulation, neuroscience, muscle physiology, and intestinal aging.
| Species | Application | Title |
|---|---|---|
Nat Commun Odoribacter splanchnicus rescues aging-related intestinal P-glycoprotein damage via GDP-L-fucose secretion. | ||
Metabolism Anti-sarcopenic effects of active vitamin D through modulation of anabolic and catabolic signaling pathways in human skeletal muscle: A randomized controlled trial | ||
Research (Wash D C) Novel LncRNA Gm44763 Regulates Morphine-Induced Reward Memory via MiR-298-5p-Mediated eIF4E Translation Control. | ||
Cell Death Dis Cytoskeletal protein KRT14 governs cisplatin resistance by modulating eIF4H-dependent ACOX2 translation and lipid metabolism in bladder cancer. | ||
J Immunother Cancer Genome-scale CRISPR-Cas9 screen reveals novel regulators of B7-H3 in tumor cells. | ||
Dev Cell P5CS represses tumor progression via inhibiting assembly of 48S pre-translation initiation complex. |
