Tested Applications
| Positive WB detected in | THP-1 cells, U-937 cells |
| Positive IHC detected in | human lymphoma tissue, mouse spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 7 publications below |
| IHC | See 4 publications below |
| IF | See 4 publications below |
Product Information
27642-1-AP targets Neutrophil Elastase in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26634 Product name: Recombinant human ELA2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 206-267 aa of BC074816 Sequence: LVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH Predict reactive species |
| Full Name | elastase 2, neutrophil |
| Calculated Molecular Weight | 267 aa, 29 kDa |
| Observed Molecular Weight | 30 kDa |
| GenBank Accession Number | BC074816 |
| Gene Symbol | ELA2 |
| Gene ID (NCBI) | 1991 |
| RRID | AB_2918126 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P08246 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ELA2(Neutrophil elastase) is also named as ELAL, NE, HLE, HNE, PMN-E, SERP1, GE, ELANE and belongs to the peptidase S1 family. It is a 33-kDa enzyme with several isoforms that differ in their extent of glycosylation(PMID:12223222). Human neutrophil elastase (HNE) is a serine protease with potent proteolytic activity (3), which is reported to cause mucin secretion (degranulation)(PMID:12169572). It may contribute to the directed migration of leukocytes into flamed postcapillary venules in addition to contributing to the process of tissue emigration(PMID:9683424). The full length protein has a signal peptide,propeptide and three glycosylation sites.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Neutrophil Elastase antibody 27642-1-AP | Download protocol |
| IHC protocol for Neutrophil Elastase antibody 27642-1-AP | Download protocol |
| WB protocol for Neutrophil Elastase antibody 27642-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Mol Biol Lett Obacunone alleviates ferroptosis during lipopolysaccharide-induced acute lung injury by upregulating Nrf2-dependent antioxidant responses. | ||
Animals (Basel) Effects of Hormone, NEFA and SCFA on the Migration of Neutrophils and the Formation of Neutrophil Extracellular Traps in Dairy Cows. | ||
Front Pharmacol RNA-sequencing approach for exploring the protective mechanisms of dexmedetomidine on pancreatic injury in severe acute pancreatitis | ||
Int Immunopharmacol N-formyl methionine mediates NETosis of neutrophil to promote sepsis-induced cardiomyopathy via the FPR1 pathway | ||
Pharmacol Res Cardiac PDK4 promotes neutrophilic PFKL methylation and drives the innate immune response in diabetic myocardial infarction | ||
Sci Rep Persistent neutrophilic inflammation is associated with delayed toxicity of phenylarsine oxide in lungs |









