CoraLite® Plus 488-conjugated Neutrophil Elastase Polyclonal antibody

• 

  IF Staining of HEK-293 using CL488-27642

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using CoraLite® Plus 488 Neutrophil Elastase antibody (CL488-27642) at dilution of 1:200.

Neutrophil Elastase Polyclonal Antibody for IF/ICC

Cat No. CL488-27642

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

ELA2, ELANE, EC:3.4.21.37, Elastase 2, HLE

---

Tested Applications

• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-27642 targets Neutrophil Elastase in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26634

  Product name: Recombinant human ELA2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 206-267 aa of BC074816

  Sequence: LVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH

• Full Name: elastase 2, neutrophil
• Calculated Molecular Weight: 267 aa, 29 kDa
• Observed Molecular Weight: 29 kDa
• GenBank Accession Number: BC074816
• Gene Symbol: ELA2
• Gene ID (NCBI): 1991
• RRID: AB_3084110
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P08246
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

ELA2(Neutrophil elastase) is also named as ELAL, NE, HLE, HNE, PMN-E, SERP1, GE, ELANE and belongs to the peptidase S1 family. It is a 33-kDa enzyme with several isoforms that differ in their extent of glycosylation(PMID:12223222). Human neutrophil elastase (HNE) is a serine protease with potent proteolytic activity (3), which is reported to cause mucin secretion (degranulation)(PMID:12169572). It may contribute to the directed migration of leukocytes into flamed postcapillary venules in addition to contributing to the process of tissue emigration(PMID:9683424). The full length protein has a signal peptide,propeptide and three glycosylation sites.