ELOF1 Polyclonal antibody

• 

  WB analysis using 21070-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21070-1-AP (ELOF1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 21070-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21070-1-AP (ELOF1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IF Staining of A549 using 21070-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using ELOF1 antibody (21070-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  IF Staining of SKOV-3 using 21070-1-AP

  Immunofluorescent analysis of (4% PFA) fixed SKOV-3 cells using ELOF1 antibody (21070-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

ELOF1 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 21070-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

ELF1

---

Tested Applications

• Positive WB detected in: mouse testis tissue, HEK-293 cells, rat testis tissue
• Positive IF/ICC detected in: A549 cells, SKOV-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21070-1-AP targets ELOF1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15213

  Product name: Recombinant human ELOF1 protein

  Source: e coli.-derived, PKG

  Tag: GST

  Domain: 1-83 aa of BC007516

  Sequence: MGRRKSKRKPPPKKKMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACEAANQ

• Full Name: elongation factor 1 homolog (S. cerevisiae)
• Calculated Molecular Weight: 9.5 kDa
• Observed Molecular Weight: 9 kDa
• GenBank Accession Number: BC007516
• Gene Symbol: ELOF1
• Gene ID (NCBI): 84337
• RRID: AB_10693632
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P60002
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ELOF1 (elongation factor 1 homologue) is a small (83 aa), evolutionarily conserved, RNAPII-associated transcription elongation factor that is also a core component of the transcription-coupled DNA repair machinery with an additional role in preventing DNA damage during DNA replication (PMID: 34108663). Loss of ELOF1 strongly compromises AID-mediated deamination, SHM, and CSR, and that this is accompanied by a decrease in parameters of RNAPII pausing/stalling and in RNAPII RNA synthesis without a decrease in levels of S2P-RNAPII (PMID: 39386505).