Tested Applications
Positive WB detected in | mouse testis tissue, HEK-293 cells, rat testis tissue |
Positive IF/ICC detected in | A549 cells, SKOV-3 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
21070-1-AP targets ELOF1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag15213 Product name: Recombinant human ELOF1 protein Source: e coli.-derived, PKG Tag: GST Domain: 1-83 aa of BC007516 Sequence: MGRRKSKRKPPPKKKMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACEAANQ Predict reactive species |
Full Name | elongation factor 1 homolog (S. cerevisiae) |
Calculated Molecular Weight | 9.5 kDa |
Observed Molecular Weight | 9 kDa |
GenBank Accession Number | BC007516 |
Gene Symbol | ELOF1 |
Gene ID (NCBI) | 84337 |
RRID | AB_10693632 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P60002 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ELOF1 (elongation factor 1 homologue) is a small (83 aa), evolutionarily conserved, RNAPII-associated transcription elongation factor that is also a core component of the transcription-coupled DNA repair machinery with an additional role in preventing DNA damage during DNA replication (PMID: 34108663). Loss of ELOF1 strongly compromises AID-mediated deamination, SHM, and CSR, and that this is accompanied by a decrease in parameters of RNAPII pausing/stalling and in RNAPII RNA synthesis without a decrease in levels of S2P-RNAPII (PMID: 39386505).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ELOF1 antibody 21070-1-AP | Download protocol |
IF protocol for ELOF1 antibody 21070-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |