Tested Applications
| Positive WB detected in | HeLa cells, MCF-7 cells, mouse kidney tissue, rat kidney tissue |
| Positive IHC detected in | mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells, HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| IF | See 1 publications below |
Product Information
26599-1-AP targets ELOVL5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24786 Product name: Recombinant human ELOVL5 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 30-104 aa of BC017270 Sequence: CTFPLGWLYFQIGYMISLIALFTNFYIQTYNKKGASRRKDHLKDHQNGSMAAVNGHTNSFSPLENNVKPRKLRKD Predict reactive species |
| Full Name | ELOVL family member 5, elongation of long chain fatty acids (FEN1/Elo2, SUR4/Elo3-like, yeast) |
| Calculated Molecular Weight | 299 aa, 35 kDa |
| Observed Molecular Weight | 25 kDa |
| GenBank Accession Number | BC017270 |
| Gene Symbol | ELOVL5 |
| Gene ID (NCBI) | 60481 |
| RRID | AB_3669551 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NYP7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Very long-chain fatty acid elongase 5 (ELOVL5) is a key enzyme for the endogenous synthesis of long-chain unsaturated fatty acids. A critical role of ELOVL5 in elongating fatty acid substrates ranging from 16 to 20 carbons was reported in humans and rodents (PMID: 29454701). ELOVL5 is involved in metastasis through lipid droplets-regulated TGF-β receptor expression and is a predictive biomarker of metastatic ER+ breast cancer (PMID: 36056008). Western blot analysis detected ELOVL51 at an apparent molecular mass of ~25 kDa (PMID: 36056008, 32527375).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ELOVL5 antibody 26599-1-AP | Download protocol |
| IHC protocol for ELOVL5 antibody 26599-1-AP | Download protocol |
| WB protocol for ELOVL5 antibody 26599-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Dipanwita (Verified Customer) (04-27-2026) | I tried the ELOVL5 for my western blot for granulosa cells, the bands were crisp and neat
|
FH Meixin (Verified Customer) (10-14-2025) | The antibody showed a clean and specific band, with very low background in Western blot. The signal was strong and stable, and no non-specific bands were observed, indicating excellent specificity and quality.
|











