ELOVL5 Polyclonal antibody

• 

  WB analysis of HeLa using 26599-1-AP

  WB result of ELOVL5 antibody (26599-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ELOVL5 transfected HeLa cells.

• 

  WB analysis using 26599-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26599-1-AP (ELOVL5 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse liver using 26599-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 26599-1-AP (ELOVL5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 26599-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 26599-1-AP (ELOVL5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 26599-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using ELOVL5 antibody (26599-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

• 

  IF Staining of HepG2 using 26599-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using ELOVL5 antibody (26599-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

• Featured Product
• KD/KO Validated

ELOVL5 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 26599-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

ELOVL2, ELOVL5, Fatty acid elongase 5, HELO1

---

Tested Applications

• Positive WB detected in: HeLa cells, MCF-7 cells, mouse kidney tissue, rat kidney tissue
• Positive IHC detected in: mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26599-1-AP targets ELOVL5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24786

  Product name: Recombinant human ELOVL5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 30-104 aa of BC017270

  Sequence: CTFPLGWLYFQIGYMISLIALFTNFYIQTYNKKGASRRKDHLKDHQNGSMAAVNGHTNSFSPLENNVKPRKLRKD

• Full Name: ELOVL family member 5, elongation of long chain fatty acids (FEN1/Elo2, SUR4/Elo3-like, yeast)
• Calculated Molecular Weight: 299 aa, 35 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC017270
• Gene Symbol: ELOVL5
• Gene ID (NCBI): 60481
• RRID: AB_3669551
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NYP7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Very long-chain fatty acid elongase 5 (ELOVL5) is a key enzyme for the endogenous synthesis of long-chain unsaturated fatty acids. A critical role of ELOVL5 in elongating fatty acid substrates ranging from 16 to 20 carbons was reported in humans and rodents (PMID: 29454701). ELOVL5 is involved in metastasis through lipid droplets-regulated TGF-β receptor expression and is a predictive biomarker of metastatic ER+ breast cancer (PMID: 36056008). Western blot analysis detected ELOVL51 at an apparent molecular mass of ~25 kDa (PMID: 36056008, 32527375).

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Meixin (Verified Customer) (10-14-2025)

The antibody showed a clean and specific band, with very low background in Western blot. The signal was strong and stable, and no non-specific bands were observed, indicating excellent specificity and quality.

• Applications: Western Blot