Tested Applications
| Positive WB detected in | A431 cells, U-251 cells, MCF-7 cells, HUVEC cells, NIH/3T3 cells |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
| IHC | See 1 publications below |
Product Information
26421-1-AP targets ENAH in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24200 Product name: Recombinant human ENAH protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 501-577 aa of BC095481 Sequence: NTMNGSKSPVISRRDSPRKNQIVFDNRSYDSLHRPKSTPLSQPSANGVQTEGLDYDRLKQDILDEMRKELTKLKEEL Predict reactive species |
| Full Name | enabled homolog (Drosophila) |
| Calculated Molecular Weight | 591 aa, 67 kDa |
| Observed Molecular Weight | 85-88 kDa, 75-80 kDa |
| GenBank Accession Number | BC095481 |
| Gene Symbol | ENAH |
| Gene ID (NCBI) | 55740 |
| RRID | AB_2880509 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8N8S7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ENAH antibody 26421-1-AP | Download protocol |
| IHC protocol for ENAH antibody 26421-1-AP | Download protocol |
| WB protocol for ENAH antibody 26421-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |











