ENOPH1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ENOPH1 Polyclonal antibody (11763-1-AP)

• Featured Product
• KD/KO Validated

ENOPH1 Polyclonal Antibody for WB, ELISA

Cat No. 11763-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF, ELISA

Synonyms

E1, enolase phosphatase 1, Enolase phosphatase E1, ENOPH1, MASA, MASA homolog, MST145

• 

  WB analysis using 11763-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 11763-1-AP (ENOPH1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HL-60 using 11763-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 11763-1-AP (ENOPH1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ENOPH1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: K-562 cells, HL-60 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11763-1-AP targets ENOPH1 in WB, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2360

  Product name: Recombinant human ENOPH1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-115 aa of BC001317

  Sequence: MKVYIYSSGSVEAQKLLFGHSTEGDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSST

• Full Name: enolase-phosphatase 1
• Calculated Molecular Weight: 13 kDa / 29 kDa
• Observed Molecular Weight: 29-35 kDa
• GenBank Accession Number: BC001317
• Gene Symbol: ENOPH1
• Gene ID (NCBI): 58478
• RRID: AB_10794441
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UHY7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ENOPH1, also named as MASA and MSTP145, belongs to the HAD-like hydrolase superfamily and MasA/MtnC family. ENOPH1 is a newly identified enzyme involved in L-methionine biosynthesis, which is associated with anxiety and depression. Studies have shown that ENOPH1 plays a crucial role in promoting the proliferation and migration of glioma cells (PMID: 32654229). ENOPH1 has 2 isoforms with the molecular mass of 13 and 29 kDa.

Publications

What published studies show

The ENOPH1 Polyclonal antibody (Cat# 11763-1-AP) has 2 total citations. These appear in Oncology Reports and Frontiers in Molecular Neuroscience. The cited research covers malignant glioma biology (cell proliferation and migration) and cerebral microvascular endothelial cell apoptosis following ischemia, placing the antibody's use in oncology and neuroscience.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Oncol Rep; Enolase-phosphatase 1 as a novel potential malignant glioma indicator promotes cell proliferation and migration.; Authors - Li Su ; KD Validated
human	WB,IF	Front Mol Neurosci; Cerebral Microvascular Endothelial Cell Apoptosis after Ischemia: Role of Enolase-Phosphatase 1 Activation and Aci-Reductone Dioxygenase 1 Translocation.; Authors - Yuan Zhang ; KD Validated