Tested Applications
| Positive WB detected in | mouse brain tissue, human placenta tissue, mouse kidney tissue, rat brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human liver cancer tissue, human small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14243-1-AP targets ENPP2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5499 Product name: Recombinant human ENPP2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 30-383 aa of BC034961 Sequence: AHRIKRAEGWEEGPPTVLSDSPWTNISGSCKGRCFELQEAGPPDCRCDNLCKSYTSCCHDFDELCLKTARGWECTKDRCGEVRNEENACHCSEDCLARGDCCTNYQVVCKGESHWVDDDCEEIKAAECPAGFVRPPLIIFSVDGFRASYMKKGSKVMPNIEKLRSCGTHSPYMRPVYPTKTFPNLYTLATGLYPESHGIVGNSMYDPVFDATFHLRGREKFNHRWWGGQPLWITATKQGVKAGTFFWSVVIPHERRILTILQWLTLPDHERPSVYAFYSEQPDFSGHKYGPFGPEMTNPLREIDKIVGQLMDGLKQLKLHRCVNVIFVGDHGMEDVTCDRTEFLSNYLTNVDDI Predict reactive species |
| Full Name | ectonucleotide pyrophosphatase/phosphodiesterase 2 |
| Calculated Molecular Weight | 99 kDa |
| Observed Molecular Weight | 100-110 kDa |
| GenBank Accession Number | BC034961 |
| Gene Symbol | ENPP2 |
| Gene ID (NCBI) | 5168 |
| RRID | AB_2878033 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13822 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ENPP2, Autotaxin or Extracellular lysophospholipase D, is a 863 amino acid secreted protein, which is detected in blood plasma (at protein level) (PubMed:12176993, PubMed:26371182). ENPP2 is Predominantly expressed in brain, placenta, ovary, and small intestine. ENPP2 is expressed in a number of carcinomas such as hepatocellular and prostate carcinoma, neuroblastoma and non-small-cell lung cancer. ENPP2 is expressed in body fluids such as plasma, cerebral spinal fluid (CSF), saliva, follicular and amniotic fluids. The calculated molecular weight of ENPP2 is about 100 kDa (PMID: 22301782), but modified ENPP2 is 120 kDa (PMID: 19808661). ENPP2 Hydrolyzes lysophospholipids to produce the signaling molecule lysophosphatidic acid (LPA) in extracellular fluids (PubMed:15769751, PubMed:26371182, PubMed:27754931).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for ENPP2 antibody 14243-1-AP | Download protocol |
| IP protocol for ENPP2 antibody 14243-1-AP | Download protocol |
| WB protocol for ENPP2 antibody 14243-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The ENPP2 Polyclonal antibody (Cat# 14243-1-AP) has 14 citations across journals including Nature Cardiovascular Research, Molecular Psychiatry, Thyroid, Cells, Frontiers in Pharmacology, PLoS Pathogens, and PLoS ONE. Research fields span septic cardiomyopathy, cognitive dysfunction, renal aging, heart failure, osteoblast differentiation, hepatorenal toxicity, EBV infection, hepatoma, ferroptosis, intervertebral disc degeneration, endometrial cancer, neurodevelopment, and intrahepatic cholestasis of pregnancy.
| Species | Application | Title |
|---|---|---|
Nat Cardiovasc Res Excessive HIF-1α driven by phospholipid metabolism causes septic cardiomyopathy through cytopathic hypoxia | ||
Mol Psychiatry Transthyretin, a novel prognostic marker of POCD revealed by time-series RNA-sequencing analysis | ||
Thyroid Increased thyroid hormone action alleviates hippocampal damage by down-regulating neuronal type-Ⅰ interferon signaling/necroptosis in diabetes-associated cognitive dysfunction | ||
Cells Role of Aberrantly Activated Lysophosphatidic Acid Receptor 1 Signaling Mediated Inflammation in Renal Aging. | ||
Front Pharmacol UPLC/Q-TOFMS-Based Metabolomics Approach to Reveal the Protective Role of Other Herbs in An-Gong-Niu-Huang Wan Against the Hepatorenal Toxicity of Cinnabar and Realgar. | ||
Am J Physiol Cell Physiol The Ecto-Nucleotide Pyrophosphatase/Phosphodiesterase 2 Promotes Early Osteoblast Differentiation and Mineralization in Stromal Stem Cells |
Reviews
What customers say
All three reviews rate the antibody 5 stars. Users report it works well for Western Blot and Immunohistochemistry at dilutions of 1:500 to 1:1000. One reviewer confirmed it performs perfectly in WB using concentrated media from serum-depleted PDAC cells and fibroblasts, detecting a ~120 kD band, and noted serum as a good positive control for secreted ENPP2/ATX. Another user simply stated "Autotaxin works good," and a third called it a "very good antibody." Overall, reviewers are highly satisfied with its performance across multiple applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Mounika (Verified Customer) (03-24-2026) | very Good Antibody!
|
Sai Sindhura (Verified Customer) (01-08-2026) | Autotaxin works good
|
Jacqueline (Verified Customer) (05-14-2019) | Works perfectly in western blot using concentrated media of cells that are cultured in serum-depleted conditions. Serum is a good positive control or secreted ENPP2/ATX. In our hands ~120kD
 |
