Tested Applications
| Positive WB detected in | mouse brain tissue, human placenta tissue, mouse kidney tissue, rat brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human liver cancer tissue, human small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 9 publications below |
| IHC | See 3 publications below |
Product Information
14243-1-AP targets ENPP2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5499 Product name: Recombinant human ENPP2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 30-383 aa of BC034961 Sequence: AHRIKRAEGWEEGPPTVLSDSPWTNISGSCKGRCFELQEAGPPDCRCDNLCKSYTSCCHDFDELCLKTARGWECTKDRCGEVRNEENACHCSEDCLARGDCCTNYQVVCKGESHWVDDDCEEIKAAECPAGFVRPPLIIFSVDGFRASYMKKGSKVMPNIEKLRSCGTHSPYMRPVYPTKTFPNLYTLATGLYPESHGIVGNSMYDPVFDATFHLRGREKFNHRWWGGQPLWITATKQGVKAGTFFWSVVIPHERRILTILQWLTLPDHERPSVYAFYSEQPDFSGHKYGPFGPEMTNPLREIDKIVGQLMDGLKQLKLHRCVNVIFVGDHGMEDVTCDRTEFLSNYLTNVDDI Predict reactive species |
| Full Name | ectonucleotide pyrophosphatase/phosphodiesterase 2 |
| Calculated Molecular Weight | 99 kDa |
| Observed Molecular Weight | 100-110 kDa |
| GenBank Accession Number | BC034961 |
| Gene Symbol | ENPP2 |
| Gene ID (NCBI) | 5168 |
| RRID | AB_2878033 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13822 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ENPP2, Autotaxin or Extracellular lysophospholipase D, is a 863 amino acid secreted protein, which is detected in blood plasma (at protein level) (PubMed:12176993, PubMed:26371182). ENPP2 is Predominantly expressed in brain, placenta, ovary, and small intestine. ENPP2 is expressed in a number of carcinomas such as hepatocellular and prostate carcinoma, neuroblastoma and non-small-cell lung cancer. ENPP2 is expressed in body fluids such as plasma, cerebral spinal fluid (CSF), saliva, follicular and amniotic fluids. The calculated molecular weight of ENPP2 is about 100 kDa (PMID: 22301782), but modified ENPP2 is 120 kDa (PMID: 19808661). ENPP2 Hydrolyzes lysophospholipids to produce the signaling molecule lysophosphatidic acid (LPA) in extracellular fluids (PubMed:15769751, PubMed:26371182, PubMed:27754931).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for ENPP2 antibody 14243-1-AP | Download protocol |
| IP protocol for ENPP2 antibody 14243-1-AP | Download protocol |
| WB protocol for ENPP2 antibody 14243-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Psychiatry Transthyretin, a novel prognostic marker of POCD revealed by time-series RNA-sequencing analysis | ||
PLoS Pathog Reduced IRF4 expression promotes lytic phenotype in Type 2 EBV-infected B cells. | ||
Cells Role of Aberrantly Activated Lysophosphatidic Acid Receptor 1 Signaling Mediated Inflammation in Renal Aging. | ||
Front Pharmacol UPLC/Q-TOFMS-Based Metabolomics Approach to Reveal the Protective Role of Other Herbs in An-Gong-Niu-Huang Wan Against the Hepatorenal Toxicity of Cinnabar and Realgar. | ||
Heliyon Secreted proteins in plasma and placenta as novel non-invasive biomarkers for intrahepatic cholestasis of pregnancy: A case-control study | ||
Front Pharmacol The mechanism of Renshen-Fuzi herb pair for treating heart failure—Integrating a cardiovascular pharmacological assessment with serum metabolomics |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Mounika (Verified Customer) (03-24-2026) | very Good Antibody!
|
FH Sai Sindhura (Verified Customer) (01-08-2026) | Autotaxin works good
|
FH Jacqueline (Verified Customer) (05-14-2019) | Works perfectly in western blot using concentrated media of cells that are cultured in serum-depleted conditions. Serum is a good positive control or secreted ENPP2/ATX. In our hands ~120kD
![]() |
















