Tested Applications
| Positive WB detected in | HeLa cells |
| Positive IHC detected in | human ovary tumor tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:150-1:600 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24558-1-AP targets ENTPD7 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18417 Product name: Recombinant human ENTPD7 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 339-413 aa of BC122857 Sequence: LGQKTGLSPDNPFLDPCLPVGLTDVVERNSQVLHVRGRGDWVSCGAMLSPLLARSNTSQASLNGIYQSPIDFNNS Predict reactive species |
| Full Name | ectonucleoside triphosphate diphosphohydrolase 7 |
| Calculated Molecular Weight | 604 aa, 69 kDa |
| Observed Molecular Weight | 69 kDa |
| GenBank Accession Number | BC122857 |
| Gene Symbol | ENTPD7 |
| Gene ID (NCBI) | 57089 |
| RRID | AB_2879607 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NQZ7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Ectonucleoside triphosphate diphosphohydrolase 7 (ENTPD7), also known as LALP1, is a member of the ecto-nucleoside triphosphate diphosphohydrolase (E-NTPDase) family. It is located in the nucleoplasm and has an effect on oxidative stress, DNA damage and ageing (PMID: 27737960).







