EOMES/TBR2 Recombinant monoclonal antibody, PBS Only

EOMES/TBR2 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 83945-5-PBS
Clone No.241036D9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

EOMES, TBR2, 241036D9, Eomesodermin homolog, T box brain protein 2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Product Information

83945-5-PBS targets EOMES/TBR2 in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag27634

Product name: Recombinant human EOMES protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 575-676 aa of NM_001278182

Sequence: MWGGRGSYQRKMAAGLPWTSRTSPTVFSEDQLSKEKVKEEIGSSWIETPPSIKSLDSNDSGVYTSACKRRRLSPSNSSNENSPSIKCEDINAEEYSKDTSKGM

Predict reactive species
Full Name eomesodermin homolog (Xenopus laevis)
Calculated Molecular Weight 73 kDa
Observed Molecular Weight 67 kDa
GenBank Accession NumberNM_001278182
Gene Symbol EOMES
Gene ID (NCBI) 8320
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDO95936
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

EOMES/TRB2 (also named Eomesodermin/Tbr2) encode T-box transcription factor expressed highly in the intermediate progenitor stage of the developing neuron. During migration of the neurons, radial glia divide and migrate towards the surface of the cerebral cortex, there are three stages of cellular development: radial glia, intermediate progenitors, and postmitotic projection neurons. Radial glia express Pax6, while intermediate progenitor cells express Eomesodermin/Tbr2, and postmitotic projection neurons express Tbr1 (PMID:15634788; PMID:16320258). This process also called neurogenesis, and demonstrated that Eomesodermin/Tbr2 has been implicated in neurodevelopment. According to the mouse model, several articles showed that EOMES/TRB2 KO mice having proliferating cells decreased and having smaller upper cortical layers and a smaller sub ventricular zone in the brain (PMID:18940588). What's more, Eomesodermin/Tbr2 has also been found participating in immune response (PMID:20713880).

Protocols

Product Specific Protocols
FC protocol for EOMES/TBR2 antibody 83945-5-PBSDownload protocol
IHC protocol for EOMES/TBR2 antibody 83945-5-PBSDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...