• KD/KO Validated

CoraLite® Plus 488-conjugated EPHA7 Monoclonal antibody

EPHA7 Monoclonal Antibody for
Cat No. CL488-66667
Clone No.1A7E5

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat, Pig

Applications

EPH homology kinase 3, EK11, EHK-3, EHK3, EHK 3

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

CL488-66667 targets EPHA7 in applications and shows reactivity with Human, Mouse, Rat, Pig samples.

Tested Reactivity Human, Mouse, Rat, Pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag3813

Product name: Recombinant human EPHA7 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 29-279 aa of BC027940

Sequence: AAKEVLLLDSKAQQTELEWISSPPNGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNVRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEEEAENAPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCECK

Predict reactive species
Full Name EPH receptor A7
Calculated Molecular Weight 998 aa, 112 kDa
Observed Molecular Weight 120 kDa
GenBank Accession NumberBC027940
Gene Symbol EPHA7
Gene ID (NCBI) 2045
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ15375
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Ephrin receptor A7 (EphA7) is a member of the Eph receptor family. EPHA7 plays a role in corticogenesis processes, determines brain size and shape, and is involved in development of the central nervous system (PMID:34176129). In addition, EphA7 also has a dual role of tumor promoter and tumor suppressor. It can participate in cell proliferation, migration and apoptosis through various mechanisms, and afect tumor diferentiation, staging and prognosis. EphA7 may be a potential diagnostic marker and tumor treatment target (PMID:35112312).

Loading...
||
New chat

Able

正在加载,请稍候...