CoraLite® Plus 647-conjugated EPHA7 Monoclonal antibody

• 

  FC experiment of SH-SY5Y using CL647-66667

  1x10^6 SH-SY5Y cells were intracellularly stained with 0.4 ug Coralite® Plus 647 Epha7 Monoclonal Antibody (CL647-66667, Clone:1A7E5)(red), or 0.4 ug CoraLite® Plus 647 Mouse IgG1 Isotype Control (MOPC-21) (CL647-65124, Clone: MOPC-21) (blue). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

• Featured Product
• KD/KO Validated

EPHA7 Monoclonal Antibody for FC (Intra)

Cat No. CL647-66667

Clone No.1A7E5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

FC (Intra)

Synonyms

EC:2.7.10.1, EHK 3, EHK3, EHK-3, EK11

---

Tested Applications

• Positive FC (Intra) detected in: SH-SY5Y cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.4 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-66667 targets EPHA7 in FC (Intra) applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3813

  Product name: Recombinant human EPHA7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 29-279 aa of BC027940

  Sequence: AAKEVLLLDSKAQQTELEWISSPPNGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNVRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEEEAENAPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCECK

• Full Name: EPH receptor A7
• Calculated Molecular Weight: 998 aa, 112 kDa
• Observed Molecular Weight: 120 kDa
• GenBank Accession Number: BC027940
• Gene Symbol: EPHA7
• Gene ID (NCBI): 2045
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q15375
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Ephrin receptor A7 (EphA7) is a member of the Eph receptor family. EPHA7 plays a role in corticogenesis processes, determines brain size and shape, and is involved in development of the central nervous system (PMID:34176129). In addition, EphA7 also has a dual role of tumor promoter and tumor suppressor. It can participate in cell proliferation, migration and apoptosis through various mechanisms, and afect tumor diferentiation, staging and prognosis. EphA7 may be a potential diagnostic marker and tumor treatment target (PMID:35112312).