Product Information
83277-1-PBS targets EPHB2 in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag28786 Product name: Recombinant human EPHB2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 886-986 aa of BC018763 Sequence: NPNSLKAMAPLSSGINLPLLDRTIPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQSVEG Predict reactive species |
| Full Name | EPH receptor B2 |
| Calculated Molecular Weight | 987 aa, 108 kDa |
| Observed Molecular Weight | 120 kDa |
| GenBank Accession Number | BC018763 |
| Gene Symbol | EPHB2 |
| Gene ID (NCBI) | 2048 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | P29323 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |



