EPHB2 Recombinant monoclonal antibody

• 

  WB analysis using 83277-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83277-1-RR (EPHB2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  FC experiment of HepG2 using 83277-1-RR

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug EPHB2 Recombinant antibody (83277-1-RR, Clone:230111A5) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

EPHB2 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 83277-1-RR

Clone No.230111A5

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

230111A5, CAPB, Developmentally-regulated Eph-related tyrosine kinase, DRT, EC:2.7.10.1

---

Tested Applications

• Positive WB detected in: HepG2 cells, U-251 cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

83277-1-RR targets EPHB2 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag28786

  Product name: Recombinant human EPHB2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 886-986 aa of BC018763

  Sequence: NPNSLKAMAPLSSGINLPLLDRTIPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQSVEG

• Full Name: EPH receptor B2
• Calculated Molecular Weight: 987 aa, 108 kDa
• Observed Molecular Weight: 120 kDa
• GenBank Accession Number: BC018763
• Gene Symbol: EPHB2
• Gene ID (NCBI): 2048
• RRID: AB_3670947
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P29323
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Exp Clin Cancer Res; tsRNA-GlyGCC promotes colorectal cancer progression and 5-FU resistance by regulating SPIB; Authors - Rong Xu