ERAB Monoclonal antibody, PBS Only (Capture)

• 

  WB analysis of HEK-293 using 60069-1-Ig (same clone as 60069-1-PBS)

  WB result of ERAB antibody (60069-1-Ig; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ERAB transfected HEK-293 cells. This data was developed using the same antibody clone with 60069-1-PBS in a different storage buffer formulation.

• 

  WB analysis of ROS1728 using 60069-1-Ig (same clone as 60069-1-PBS)

  ROS1728 cells were subjected to SDS PAGE followed by western blot with 60069-1-Ig (ERAB Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60069-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 60069-1-Ig (same clone as 60069-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 60069-1-Ig (ERAB Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60069-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 60069-1-Ig (same clone as 60069-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 60069-1-Ig (ERAB Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60069-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 60069-1-Ig (same clone as 60069-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 60069-1-Ig (ERAB Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60069-1-PBS in a different storage buffer formulation.

• 

  WB analysis of RAW 264.7 using 60069-1-Ig (same clone as 60069-1-PBS)

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 60069-1-Ig (ERAB Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60069-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 60069-1-Ig (same clone as 60069-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 60069-1-Ig (ERAB antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60069-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 60069-1-Ig (same clone as 60069-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 60069-1-Ig (ERAB antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60069-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP50654-2

  Cytometric bead array standard curve of MP50654-2, HSD17B10 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 60069-1-PBS. Detection antibody: 60069-4-PBS. Standard:Ag1020. Range: 0.098-50 ng/mL.

• Featured Product
• KD/KO Validated

ERAB Monoclonal Antibody for WB, IHC, Cytometric bead array, Indirect ELISA

Cat No. 60069-1-PBS

Clone No.1G5E5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

Synonyms

HSD17B10, 3-hydroxy-2-methylbutyryl-CoA dehydrogenase, 3alpha(or 20beta)-hydroxysteroid dehydrogenase, 3-alpha-(17-beta)-hydroxysteroid dehydrogenase, 2-methyl-3-hydroxybutyryl-CoA dehydrogenase

---

Product Information

60069-1-PBS targets ERAB as part of a matched antibody pair:

MP50654-2: 60069-1-PBS capture and 60069-4-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1020

  Product name: Recombinant human HSD17B10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-252 aa of BC008708

  Sequence: MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP

• Full Name: hydroxysteroid (17-beta) dehydrogenase 10
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC008708
• Gene Symbol: ERAB
• Gene ID (NCBI): 3028
• RRID: AB_2119779
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q99714
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HSD17B10 (3-hydroxyacyl-CoA dehydrogenase type-2) is a multifunctional mitochondrial enzyme that acts on a wide spectrum of substrates, including neuroactive steroids, alcohols, leucine, and fatty acids, with a preference for short-chain methyl-branched acyl-CoAs(PMID:15860413).It has 2 isoforms produced by alternative splicing.Defects in HSD17B10 are the cause of 2-methyl-3-hydroxybutyryl-CoA dehydrogenase deficiency (MHBD deficiency) and mental retardation syndromic X-linked type 10 (MRXS10).