• Featured Product
  • KD/KO Validated

ERAB Monoclonal antibody, PBS Only (Capture)

ERAB Monoclonal Antibody for WB, IHC, Cytometric bead array, Indirect ELISA

Cat No. 60069-1-PBS
Clone No.1G5E5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

HSD17B10, 3-hydroxy-2-methylbutyryl-CoA dehydrogenase, 3alpha(or 20beta)-hydroxysteroid dehydrogenase, 3-alpha-(17-beta)-hydroxysteroid dehydrogenase, 2-methyl-3-hydroxybutyryl-CoA dehydrogenase

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60069-1-PBS targets ERAB as part of a matched antibody pair:

MP50654-2: 60069-1-PBS capture and 60069-4-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag1020

Product name: Recombinant human HSD17B10 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-252 aa of BC008708

Sequence: MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP

Predict reactive species
Full Name hydroxysteroid (17-beta) dehydrogenase 10
Calculated Molecular Weight 26 kDa
Observed Molecular Weight 27 kDa
GenBank Accession NumberBC008708
Gene Symbol ERAB
Gene ID (NCBI) 3028
RRIDAB_2119779
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ99714
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

HSD17B10 (3-hydroxyacyl-CoA dehydrogenase type-2) is a multifunctional mitochondrial enzyme that acts on a wide spectrum of substrates, including neuroactive steroids, alcohols, leucine, and fatty acids, with a preference for short-chain methyl-branched acyl-CoAs(PMID:15860413).It has 2 isoforms produced by alternative splicing.Defects in HSD17B10 are the cause of 2-methyl-3-hydroxybutyryl-CoA dehydrogenase deficiency (MHBD deficiency) and mental retardation syndromic X-linked type 10 (MRXS10).

Loading...
||
New chat Able
正在加载,请稍候...