ERAB Monoclonal antibody

• Home
• Products
• Primary Antibodies
• ERAB Monoclonal antibody (60069-1-Ig)

• Featured Product
• KD/KO Validated

ERAB Monoclonal Antibody for WB, IHC, ELISA

Cat No. 60069-1-Ig

Clone No.1G5E5

Publications(1)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

HSD17B10, 17-beta-estradiol 17-dehydrogenase, 1G5E5, 2-methyl-3-hydroxybutyryl-CoA dehydrogenase, 3-alpha-(17-beta)-hydroxysteroid dehydrogenase

• 

  WB analysis of HEK-293 using 60069-1-Ig

  WB result of ERAB antibody (60069-1-Ig; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ERAB transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of ROS1728 using 60069-1-Ig

  ROS1728 cells were subjected to SDS PAGE followed by western blot with 60069-1-Ig (ERAB Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 60069-1-Ig

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 60069-1-Ig (ERAB Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 60069-1-Ig

  HeLa cells were subjected to SDS PAGE followed by western blot with 60069-1-Ig (ERAB Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 60069-1-Ig

  Jurkat cells were subjected to SDS PAGE followed by western blot with 60069-1-Ig (ERAB Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of RAW 264.7 using 60069-1-Ig

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 60069-1-Ig (ERAB Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 60069-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 60069-1-Ig (ERAB antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 60069-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 60069-1-Ig (ERAB antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: ROS1728 cells, RAW 264.7 cells, Jurkat cells, HEK-293 cells, HeLa cells
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

60069-1-Ig targets ERAB in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1020

  Product name: Recombinant human HSD17B10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-252 aa of BC008708

  Sequence: MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP

• Full Name: hydroxysteroid (17-beta) dehydrogenase 10
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC008708
• Gene Symbol: ERAB
• Gene ID (NCBI): 3028
• RRID: AB_2119779
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q99714
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HSD17B10 (3-hydroxyacyl-CoA dehydrogenase type-2) is a multifunctional mitochondrial enzyme that acts on a wide spectrum of substrates, including neuroactive steroids, alcohols, leucine, and fatty acids, with a preference for short-chain methyl-branched acyl-CoAs(PMID:15860413).It has 2 isoforms produced by alternative splicing.Defects in HSD17B10 are the cause of 2-methyl-3-hydroxybutyryl-CoA dehydrogenase deficiency (MHBD deficiency) and mental retardation syndromic X-linked type 10 (MRXS10).

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Fetal Pediatr Pathol; Utility of Integrating Genome-Wide Postmortem Testing into Clinical Autopsy Practice in Pediatrics: A Retrospective, Single-Center Study.; Authors - Noriko Watanabe