ERAB Monoclonal antibody

• 

  WB analysis of HEK-293 using 60069-1-Ig

  WB result of ERAB antibody (60069-1-Ig; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ERAB transfected HEK-293 cells.

• 

  WB analysis of ROS1728 using 60069-1-Ig

  ROS1728 cells were subjected to SDS PAGE followed by western blot with 60069-1-Ig (ERAB Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 60069-1-Ig

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 60069-1-Ig (ERAB Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 60069-1-Ig

  HeLa cells were subjected to SDS PAGE followed by western blot with 60069-1-Ig (ERAB Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 60069-1-Ig

  Jurkat cells were subjected to SDS PAGE followed by western blot with 60069-1-Ig (ERAB Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of RAW 264.7 using 60069-1-Ig

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 60069-1-Ig (ERAB Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 60069-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 60069-1-Ig (ERAB antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 60069-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 60069-1-Ig (ERAB antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

ERAB Monoclonal Antibody for WB, IHC, ELISA

Cat No. 60069-1-Ig

Clone No.1G5E5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

17 beta HSD 10, 17b HSD10, ABAD, CAMR, DUPXp11.22, ERAB, HADH2, HCD2, HSD17B10, MHBD, MRPP2, MRX17, MRX31, MRXS10, SCHAD, SDR5C1, Type II HADH, XH98G2

---

Tested Applications

• Positive WB detected in: ROS1728 cells, RAW 264.7 cells, Jurkat cells, HEK-293 cells, HeLa cells
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

60069-1-Ig targets ERAB in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1020

  Product name: Recombinant human HSD17B10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-252 aa of BC008708

  Sequence: MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP

• Full Name: hydroxysteroid (17-beta) dehydrogenase 10
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC008708
• Gene Symbol: ERAB
• Gene ID (NCBI): 3028
• RRID: AB_2119779
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q99714
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HSD17B10 (3-hydroxyacyl-CoA dehydrogenase type-2) is a multifunctional mitochondrial enzyme that acts on a wide spectrum of substrates, including neuroactive steroids, alcohols, leucine, and fatty acids, with a preference for short-chain methyl-branched acyl-CoAs(PMID:15860413).It has 2 isoforms produced by alternative splicing.Defects in HSD17B10 are the cause of 2-methyl-3-hydroxybutyryl-CoA dehydrogenase deficiency (MHBD deficiency) and mental retardation syndromic X-linked type 10 (MRXS10).