ESCO2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ESCO2 Polyclonal antibody, PBS Only (23525-1-PBS)

• 

  WB analysis using 23525-1-AP (same clone as 23525-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 23525-1-AP (ESCO2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23525-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 23525-1-AP (same clone as 23525-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 23525-1-AP (ESCO2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23525-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin cancer using 23525-1-AP (same clone as 23525-1-PBS)

  Immunohistochemical analysis of paraffin-embedded skin cancer slide using 23525-1-AP (ESCO2 antibody) at dilution of 1:300 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 23525-1-PBS in a different storage buffer formulation.

ESCO2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 23525-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

N acetyltransferase ESCO2, hEFO2, Establishment factor-like protein 2, EFO2p, EFO2

---

Product Information

23525-1-PBS targets ESCO2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18893

  Product name: Recombinant human ESCO2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-353 aa of BC146562

  Sequence: MAALTPRKRKQDSLKCDSLLHFTENLFPSPNKKHCFYQNSDKNEENLHCSQQEHFVLSALKTTEINRLPSANQGSPFKSALSTVSFYNQNKWYLNPLERKLIKESRSTCLKTNDEDKSFPIVTEKMQGKPVCSKKNNKKPQKSLTAKYQPKYRHIKPVSRNSRNSKQNRVIYKPIVEKENNCHSAENNSNAPRVLSQKIKPQVTLQGGAAFFVRKKSSLRKSSLENEPSLGRTQKSKSEVIEDSDVETVSEKKTFATRQVPKCLVLEEKLKIGLLSASSKNKEKLIKDSSDDRVSSKEHKVDKNEAFSSEDSLGENKTISPKSTVYPIFSASSVNSKRSLGEEQFSVGSVNFM

• Full Name: establishment of cohesion 1 homolog 2 (S. cerevisiae)
• Calculated Molecular Weight: 601 aa, 68 kDa
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC146562
• Gene Symbol: ESCO2
• Gene ID (NCBI): 157570
• RRID: AB_2879292
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q56NI9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ESCO2 is also known as Establishment of Sister Chromatid Cohesion N-Acetyltransferase 2, EFO2. This gene encodes a member of the family of acetyltransferases involved in the establishment of sister chromatid cohesion during S phase and postreplicative sister chromatid cohesion induced by double-strand breaks (PubMed: 15821733). Mutations in the ESCO2 gene are associated with a rare genetic disorder called Roberts syndrome or SC phocomelia syndrome (PubMed: 16380922). The loss of function or impaired activity of the ESCO2 protein due to mutations disrupts the proper cohesion of sister chromatids, leading to chromosomal abnormalities and the characteristic features of Roberts syndrome. ESCO2 can be detected as about 65-70 kDa.