CoraLite®555-conjugated EXOSC2 Monoclonal antibody

• 

  FC experiment of HepG2 using CL555-66099

  1X10^6 HepG2 cells were intracellularly stained with 0.8 ug CoraLite®555 Anti-Human EXOSC2 (CL555-66099, Clone:1G8B1) (red), or 0.8 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

EXOSC2 Monoclonal Antibody for FC (Intra)

Cat No. CL555-66099

Clone No.1G8B1

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

FC (Intra)

Synonyms

1G8B1, Exosome complex component RRP4, Exosome component 2, hRrp4p, Ribosomal RNA-processing protein 4

---

Tested Applications

• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL555-66099 targets EXOSC2 in FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7003

  Product name: Recombinant human EXOSC2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-293 aa of BC000747

  Sequence: MAMEMRLPVARKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSVERVNKLICVKALKTRYIGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCGASVILGNNGFIWIYPTPEHKEEEAGGFIANLEPVSLADREVISRLRNCIISLVTQRMMLYDTSILYCYEASLPHQIKDILKPEIMEEIVMETRQRLLEQEG

• Full Name: exosome component 2
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC000747
• Gene Symbol: EXOSC2
• Gene ID (NCBI): 23404
• RRID: AB_3084623
• Conjugate: CoraLite®555 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 557 nm / 570 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13868
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snoRNA and snRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts, such as antisense RNA species and promoter-upstream transcripts (PROMPTs), and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and specifically degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions, and in RNA surveillance pathways, preventing translation of aberrant mRNAs [PMID:15346807]. EXOSC2 is a non-catalytic component of the RNA exosome complex that has 3'->5' exoribonuclease activity and involves in a multitude of cellular RNA processing and degradation events [PMID: 17545563].