• Featured Product
  • KD/KO Validated

EXOSC3 Polyclonal antibody

EXOSC3 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 15062-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, ELISA

Ribosomal RNA-processing protein 40, Exosome complex component RRP40, EXOSC 3, CGI-102

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA2780 cells, HEK-293T cells, PC-3 cells, NIH/3T3 cells, mouse spleen tissue
Positive IP detected inA2780 cells
Positive IF/ICC detected inPC-3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15062-1-AP targets EXOSC3 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag7065

Product name: Recombinant human EXOSC3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-275 aa of BC002437

Sequence: MAEPASVAAESLAGSRARAARTVLGQVVLPGEELLLPEQEDAEGPGGAVERPLSLNARACSRVRVVCGPGLRRCGDRLLVTKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIIQEVGKLYPLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES

Predict reactive species
Full Name exosome component 3
Calculated Molecular Weight 30 kDa
Observed Molecular Weight 31 kDa
GenBank Accession NumberBC002437
Gene Symbol EXOSC3
Gene ID (NCBI) 51010
RRIDAB_2278183
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9NQT5
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RNA exosomes are multi-subunit complexes conserved throughout evolution, and they are emerging as the major cellular machinery for processing, surveillance and turnover of a diverse spectrum of coding and noncoding RNA substrates essential for viability[PMID:22544365]. In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snRNA and snoRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts [PMID:11782436]. EXOSC3 is a non-catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and involves in a multitude of cellular RNA processing and degradation events. EXOSC3 as peripheral part of the Exo-9 complex stabilizes the hexameric ring of Rnase PH-domain subunits through contacts with EXOSC9 and EXOSC5 [PMID:21255825].

Protocols

Product Specific Protocols
IF protocol for EXOSC3 antibody 15062-1-APDownload protocol
IHC protocol for EXOSC3 antibody 15062-1-APDownload protocol
IP protocol for EXOSC3 antibody 15062-1-APDownload protocol
WB protocol for EXOSC3 antibody 15062-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
human

Mol Cell

Integrator is a genome-wide attenuator of non-productive transcription.

Authors - Søren Lykke-Andersen
  • KD Validated
mouseWB

Nucleic Acids Res

The RNA exosome contributes to gene expression regulation during stem cell differentiation.

Authors - Marta Lloret-Llinares
humanWB

Nucleic Acids Res

A short splicing isoform of HBS1L links the cytoplasmic exosome and SKI complexes in humans.

Authors - Katarzyna Kalisiak
humanWB

Nucleic Acids Res

The RNA exosome shapes the expression of key protein-coding genes.

Authors - Mengjun Wu
humanWB

Nat Commun

EXOSC8 mutations alter mRNA metabolism and cause hypomyelination with spinal muscular atrophy and cerebellar hypoplasia.

Authors - Veronika Boczonadi
humanWB

Nucleic Acids Res

A short splicing isoform of HBS1L links the cytoplasmic exosome and SKI complexes in humans.

Authors - Katarzyna Kalisiak

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Aleksandr (Verified Customer) (12-15-2025)

Worked great

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: RKO
EXOSC3 Antibody Western Blot validation (1:5000 dilution) in RKO (Cat no:15062-1-AP)
FH

Kalodiah (Verified Customer) (08-07-2025)

Antibody sample. Worked very well. Only slight background on Western blot.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HeLa and Hek293T
FH

Tsimafei (Verified Customer) (06-01-2022)

Comparison of WT and Exosc3 depletion showed a reduction in Exosc3 protein levels (confirming the specificity of the antibodies). Antibodies were incubated ON at 4C.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: mESCs
EXOSC3 Antibody Western Blot validation (1:1000 dilution) in mESCs (Cat no:15062-1-AP)
FH

Nikolaus (Verified Customer) (05-24-2022)

Exosc3 conditional KO timecourse; Hsp70 as loading control; exoscenllent abs

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/5000
  • Cell Tissue Type: mESC
EXOSC3 Antibody Western Blot validation (1/5000 dilution) in mESC (Cat no:15062-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...