CoraLite® Plus 488-conjugated EXOSC3 Polyclonal antibody

• 

  IF Staining of PC-3 using CL488-15062

  Immunofluorescent analysis of (4% PFA) fixed PC-3 cells using CoraLite® Plus 488 EXOSC3 antibody (CL488-15062) at dilution of 1:200, CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

EXOSC3 Polyclonal Antibody for IF/ICC

Cat No. CL488-15062

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

bA3J10.7, CGI 102, EXOSC3, exosome component 3, hRrp 40, hRrp40p, p10, RP11 3J10.8, RRP40, Rrp40p

---

Tested Applications

• Positive IF/ICC detected in: PC-3 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-15062 targets EXOSC3 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7065

  Product name: Recombinant human EXOSC3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-275 aa of BC002437

  Sequence: MAEPASVAAESLAGSRARAARTVLGQVVLPGEELLLPEQEDAEGPGGAVERPLSLNARACSRVRVVCGPGLRRCGDRLLVTKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIIQEVGKLYPLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES

• Full Name: exosome component 3
• Calculated Molecular Weight: 30 kDa
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: BC002437
• Gene Symbol: EXOSC3
• Gene ID (NCBI): 51010
• RRID: AB_3672618
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NQT5
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

RNA exosomes are multi-subunit complexes conserved throughout evolution, and they are emerging as the major cellular machinery for processing, surveillance and turnover of a diverse spectrum of coding and noncoding RNA substrates essential for viability[PMID:22544365]. In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snRNA and snoRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts [PMID:11782436]. EXOSC3 is a non-catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and involves in a multitude of cellular RNA processing and degradation events. EXOSC3 as peripheral part of the Exo-9 complex stabilizes the hexameric ring of Rnase PH-domain subunits through contacts with EXOSC9 and EXOSC5 [PMID:21255825].