EYA4 Polyclonal antibody, PBS Only

• 

  WB analysis using 24691-1-AP (same clone as 24691-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24691-1-AP (EYA4 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24691-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 24691-1-AP (same clone as 24691-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24691-1-AP (EYA4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24691-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skeletal muscle using 24691-1-AP (same clone as 24691-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 24691-1-AP (EYA4 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 24691-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skeletal muscle using 24691-1-AP (same clone as 24691-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 24691-1-AP (EYA4 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 24691-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 24691-1-AP (same clone as 24691-1-PBS)

  Immunofluorescent analysis of HeLa cells using 24691-1-AP (EYA4 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 24691-1-PBS in a different storage buffer formulation.

EYA4 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 24691-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

24691-1-PBS targets EYA4 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20466

  Product name: Recombinant human EYA4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 130-201 aa of BC041063

  Sequence: STPAAQTMSAYAGQTQYSGMQQPAVYTAYSQTGQPYSLPTYDLGVMLPAIKTESGLSQTQSPLQSGCLSYSP

• Full Name: eyes absent homolog 4 (Drosophila)
• Calculated Molecular Weight: 639 aa, 70 kDa
• Observed Molecular Weight: 67-70 kDa
• GenBank Accession Number: BC041063
• Gene Symbol: EYA4
• Gene ID (NCBI): 2070
• RRID: AB_2879675
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95677
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

EYA4 (Eyes absent homolog 4) participates directly in the modulation of cellular signaling through its phosphatase activity and plays a role in the embryonic and post-natal development of the mature organs of CORTI. This protein may be involved in the development of the eye. It has 5 isoforms produced by alternative splicing.