EYA4 Polyclonal antibody

• 

  WB analysis using 24691-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24691-1-AP (EYA4 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 24691-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24691-1-AP (EYA4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human skeletal muscle using 24691-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 24691-1-AP (EYA4 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human skeletal muscle using 24691-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 24691-1-AP (EYA4 Antibody) at dilution of 1:200 (under 40x lens).

• 

  IF Staining of HeLa using 24691-1-AP

  Immunofluorescent analysis of HeLa cells using 24691-1-AP (EYA4 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

EYA4 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 24691-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

CMD1J, DFNA10, EYA4, Eyes absent homolog 4

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse heart tissue, mouse liver tissue, mouse skeletal muscle tissue, L02 cells, rat liver tissue
• Positive IHC detected in: human skeletal muscle tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:100-1:400
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

24691-1-AP targets EYA4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20466

  Product name: Recombinant human EYA4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 130-201 aa of BC041063

  Sequence: STPAAQTMSAYAGQTQYSGMQQPAVYTAYSQTGQPYSLPTYDLGVMLPAIKTESGLSQTQSPLQSGCLSYSP

• Full Name: eyes absent homolog 4 (Drosophila)
• Calculated Molecular Weight: 639 aa, 70 kDa
• Observed Molecular Weight: 67-70 kDa
• GenBank Accession Number: BC041063
• Gene Symbol: EYA4
• Gene ID (NCBI): 2070
• RRID: AB_2879675
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95677
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EYA4 (Eyes absent homolog 4) participates directly in the modulation of cellular signaling through its phosphatase activity and plays a role in the embryonic and post-natal development of the mature organs of CORTI. This protein may be involved in the development of the eye. It has 5 isoforms produced by alternative splicing.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Cell Res; Lin28a maintains a subset of adult muscle stem cells in an embryonic-like state; Authors - Peng Wang
human	WB,IHC	Signal Transduct Target Ther; Phosphorylation determines the glucose metabolism reprogramming and tumor-promoting activity of sine oculis homeobox 1; Authors - Yanni Lin
pig	IF	Theriogenology; Analysis of the pluripotent and germline marker gene expression, and the state of X chromosome reactivation of primordial germ cells in pig gonads; Authors - Wenjing Yuan