EYA4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• EYA4 Polyclonal antibody (24691-1-AP)

EYA4 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 24691-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

CMD1J, DFNA10, EYA4, Eyes absent homolog 4

• 

  WB analysis using 24691-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24691-1-AP (EYA4 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 24691-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24691-1-AP (EYA4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skeletal muscle using 24691-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 24691-1-AP (EYA4 Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skeletal muscle using 24691-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 24691-1-AP (EYA4 Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 24691-1-AP

  Immunofluorescent analysis of HeLa cells using 24691-1-AP (EYA4 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for EYA4 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse heart tissue, mouse liver tissue, mouse skeletal muscle tissue, L02 cells, rat liver tissue
• Positive IHC detected in: human skeletal muscle tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:100-1:400
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24691-1-AP targets EYA4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20466

  Product name: Recombinant human EYA4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 130-201 aa of BC041063

  Sequence: STPAAQTMSAYAGQTQYSGMQQPAVYTAYSQTGQPYSLPTYDLGVMLPAIKTESGLSQTQSPLQSGCLSYSP

• Full Name: eyes absent homolog 4 (Drosophila)
• Calculated Molecular Weight: 639 aa, 70 kDa
• Observed Molecular Weight: 67-70 kDa
• GenBank Accession Number: BC041063
• Gene Symbol: EYA4
• Gene ID (NCBI): 2070
• RRID: AB_2879675
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95677
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EYA4 (Eyes absent homolog 4) participates directly in the modulation of cellular signaling through its phosphatase activity and plays a role in the embryonic and post-natal development of the mature organs of CORTI. This protein may be involved in the development of the eye. It has 5 isoforms produced by alternative splicing.

Publications

What published studies show

The EYA4 Polyclonal antibody (Cat# 24691-1-AP) has 3 total citations. These appear in Signal Transduction and Targeted Therapy, Cell Research, and Theriogenology. The associated research fields include tumor biology and glucose metabolism reprogramming, muscle stem cell maintenance and embryonic-like state regulation, and pluripotent/germline marker gene expression in pig primordial germ cells.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Signal Transduct Target Ther; Phosphorylation determines the glucose metabolism reprogramming and tumor-promoting activity of sine oculis homeobox 1; Authors - Yanni Lin
		Cell Res; Lin28a maintains a subset of adult muscle stem cells in an embryonic-like state; Authors - Peng Wang
pig	IF	Theriogenology; Analysis of the pluripotent and germline marker gene expression, and the state of X chromosome reactivation of primordial germ cells in pig gonads; Authors - Wenjing Yuan