Product Information
60231-1-PBS targets FAF1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0407 Product name: Recombinant human FAF1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 268-489 aa of BC004970 Sequence: RSSPAQTREQSEEQITDVHMVSDSDGDDFEDATEFGVDDGEVFGMASSALRKSPMMPENAENEGDALLQFTAEFSSRYGDCHPVFFIGSLEAAFQEAFYVKARDRKLLAIYLHHDESVLTNVFCSQMLCAESIVSYLSQNFITWAWDLTKDSNRARFLTMCNRHFGSVVAQTIRTQKTDQFPLFLIIMGKRSSNEVLNVIQGNTTVDELMMRLMAAMEIFTA Predict reactive species |
| Full Name | Fas (TNFRSF6) associated factor 1 |
| Calculated Molecular Weight | 650aa, 74 kDa |
| Observed Molecular Weight | 74 kDa |
| GenBank Accession Number | BC004970 |
| Gene Symbol | FAF1 |
| Gene ID (NCBI) | 11124 |
| RRID | AB_11232212 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9UNN5 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
FAF1 was detected most abundant in testis, slightly less abundant in skeletal muscle and heart, followed by prostate, thymus, ovary, small intestine, and colon, but not in the peripheral blood leukocytes.The N-terminal region (amino acid 1∼201) including the upstream ubiquitin homology domain of hFAF1 could bind with the death domain of Fas, which mediates programmed cell death, also called apoptosis, in a number of organ systems, notably the immune and nervous systems.



