FAK Polyclonal antibody, PBS Only

• 

  WB analysis using 12636-1-AP (same clone as 12636-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12636-1-AP (FAK antibody) at dilution of 1:70000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12636-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 12636-1-AP (same clone as 12636-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 12636-1-AP (FAK antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12636-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 12636-1-AP (same clone as 12636-1-PBS)

  IP result of anti-FAK (IP:12636-1-AP, 4ug; Detection:12636-1-AP 1:30000) with HeLa cells lysate 1600 ug. This data was developed using the same antibody clone with 12636-1-PBS in a different storage buffer formulation.

• 

  IHC staining of Hepatocellular carcinoma using 12636-1-AP (same clone as 12636-1-PBS)

  Immunohistochemical analysis of paraffin-embedded Hepatocellular carcinoma tissue slide using 12636-1-AP (FAK antibody) at dilution of 1:600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12636-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 12636-1-AP (same clone as 12636-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 12636-1-AP (FAK antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12636-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 12636-1-AP (same clone as 12636-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 12636-1-AP (FAK antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12636-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 12636-1-AP (same clone as 12636-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using FAK antibody (12636-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CoraLite®594 Beta Actin antibody (CL594-66009, Clone: 2D4H5, red). This data was developed using the same antibody clone with 12636-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HUVEC using 12636-1-AP (same clone as 12636-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HUVEC cells using FAK antibody (12636-1-AP) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CoraLite®594 Beta Actin antibody (CL594-66009, Clone: 2D4H5, red). This data was developed using the same antibody clone with 12636-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

FAK Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 12636-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

PTK2, EC:2.7.10.2, FADK 1, FAK1, Focal adhesion kinase 1

---

Product Information

12636-1-PBS targets FAK in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3331

  Product name: Recombinant human FAK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 381-678 aa of BC028733

  Sequence: ITAMAGSIYPGQASLLDQTDSWNHRPQEIAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGSLQGPIGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLGSLASLSSPADSYNEGVKLKPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQTR

• Full Name: PTK2 protein tyrosine kinase 2
• Calculated Molecular Weight: 1052 aa, 119 kDa
• Observed Molecular Weight: 110 kDa
• GenBank Accession Number: BC028733
• Gene Symbol: FAK
• Gene ID (NCBI): 5747
• RRID: AB_2173668
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q05397
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FAK (Focal adhesion kinase 1) is also named as FAK1, FADK, pp125FAK, FAK and belongs to the protein kinase superfamily. It is a critical tyrosine kinase that modulates cell adhesion, migration, proliferation and survival in response to extracellular signals (PMID:19664602). It also acts as a pivotal signal 'integrator', controlling and coordinating cellular responses that include cell migration, survival, proliferation and, epithelial tissue repair after DNA damage (PMID:20966971). This protein has some isoforms produced by alternative promoter usage and alternative splicing, and the range of the molecular weights are 100-120kD and 40-60kD.