FAK Monoclonal antibody

• 

  WB analysis using 66258-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66258-1-Ig (FAK antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Lamin B1 Monoclonal antibody (HRP-66095) as loading control.

• 

  WB analysis using 66258-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66258-1-Ig (FAK antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Beta Actin Monoclonal antibody (HRP-66009) as loading control.

• 

  WB analysis of MCF-7 using 66258-1-Ig

  WB result of FAK antibody (66258-1-Ig; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-FAK transfected MCF-7 cells.

• 

  WB analysis of MCF-7 using 66258-1-Ig

  Western blot analysis of FAK-specific in various cell lines using Proteintech antibody 66258-1-Ig at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human testis using 66258-1-Ig

  human testis tissue were subjected to SDS PAGE followed by western blot with 66258-1-Ig (FAK antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 66258-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66258-1-Ig (FAK antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 66258-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66258-1-Ig (FAK antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HUVEC using 66258-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HUVEC cells using FAK antibody (66258-1-Ig, Clone: 2C5B9 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red).

• 

  IF Staining of A549 using 66258-1-Ig

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using FAK antibody (66258-1-Ig, Clone: 2C5B9 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CoraLite®594 Beta Actin antibody (CL594-66009, Clone: 2D4H5, red).

• Featured Product
• KD/KO Validated

FAK Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66258-1-Ig

Clone No.2C5B9

Publications(57)

Reviews (1)

Host / Isotype

Mouse / IgG2c

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

PTK2, 2C5B9, EC:2.7.10.2, FADK 1, FAK1

---

Tested Applications

• Positive WB detected in: hTERT-RPE1 cells, human testis tissue, MCF-7 cells, HCT 116 cells, NIH/3T3 cells, RAW 264.7 cells, ROS1728 cells, HepG2 cells, HeLa cells, Jurkat cells, K-562 cells, pig brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HUVEC cells, A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 44 publications below
• IHC: See 4 publications below
• IF: See 16 publications below
• IP: See 1 publications below
• CoIP: See 1 publications below

Product Information

66258-1-Ig targets FAK in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2c
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17966

  Product name: Recombinant human FAK protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 381-678 aa of BC028733

  Sequence: ITAMAGSIYPGQASLLDQTDSWNHRPQEIAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGSLQGPIGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLGSLASLSSPADSYNEGVKLKPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQTR

• Full Name: PTK2 protein tyrosine kinase 2
• Calculated Molecular Weight: 1052 aa, 119 kDa
• Observed Molecular Weight: 110 kDa
• GenBank Accession Number: BC028733
• Gene Symbol: FAK
• Gene ID (NCBI): 5747
• RRID: AB_2881646
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q05397
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FAK (Focal adhesion kinase 1) is also named as FAK1, FADK, pp125FAK, FAK and belongs to the protein kinase superfamily. It is a critical tyrosine kinase that modulates cell adhesion, migration, proliferation and survival in response to extracellular signals (PMID:19664602). It also acts as a pivotal signal 'integrator', controlling and coordinating cellular responses that include cell migration, survival, proliferation and, epithelial tissue repair after DNA damage (PMID:20966971). This protein has some isoforms produced by alternative promoter usage and alternative splicing, and the range of the molecular weights are 100-120kD and 40-60kD.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Sci Adv; Lipid-anchored proteasomes control membrane protein homeostasis; Authors - Ruizhu Zhang
rat	WB	Acta Biomater; Sodium alginate/collagen/stromal cell-derived factor-1 neural scaffold loaded with BMSCs promotes neurological function recovery after traumatic brain injury.; Authors - Shanshan Ma
human	WB	Cancer Lett; Direct contact between tumor cells and platelets initiates a FAK-dependent F3/TGF-β positive feedback loop that promotes tumor progression and EMT in osteosarcoma; Authors - Qianyu Shi
human	WB	Oncogene; Rab34 regulates adhesion, migration, and invasion of breast cancer cells.; Authors - Lixiang Sun
human	WB	Oncogene; MiR-19a/miR-96-mediated low expression of KIF26A suppresses metastasis by regulating FAK pathway in gastric cancer.; Authors - Ran-Ran Ma
human	WB	Aging (Albany NY); TNFSF9 promotes metastasis of pancreatic cancer through Wnt/Snail signaling and M2 polarization of macrophages.; Authors - Jiao Wu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Balawant (Verified Customer) (12-02-2022)

This antibody is working great both for mice colon sample as well as for colon epithelial cells

• Applications: Western Blot
• Primary Antibody Dilution: 1:2000
• Cell Tissue Type: Mice colon tissue and caco2/HCT116 cells