FAM107B Polyclonal antibody, PBS Only

• 

  WB analysis using 20527-1-AP (same clone as 20527-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20527-1-AP (FAM107B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20527-1-PBS in a different storage buffer formulation.

FAM107B Polyclonal Antibody for WB, Indirect ELISA

Cat No. 20527-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

C10orf45, Protein FAM107B

---

Product Information

20527-1-PBS targets FAM107B in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14389

  Product name: Recombinant human FAM107B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 43-131 aa of BC004872

  Sequence: RGLAPQNKPELQKVMEKRKRDQVIKQKEEEAQKKKSDLEIELLKRQQKLEQLELEKQKLQEEQENAPEFVKVKGNLRRTGQEVAQAQES

• Full Name: family with sequence similarity 107, member B
• Calculated Molecular Weight: 131 aa, 16 kDa
• Observed Molecular Weight: 38-40 kDa
• GenBank Accession Number: BC004872
• Gene Symbol: FAM107B
• Gene ID (NCBI): 83641
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H098
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.