COX20 Polyclonal antibody

• 

  WB analysis using 25752-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 25752-1-AP (COX20 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human prostate cancer using 25752-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 25752-1-AP (COX20 antibody at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human prostate cancer using 25752-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 25752-1-AP (COX20 antibody at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human endometrial cancer using 25752-1-AP

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer tissue slide using 25752-1-AP (COX20 antibody at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human endometrial cancer using 25752-1-AP

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer tissue slide using 25752-1-AP (COX20 antibody at dilution of 1:50 (under 40x lens).

• 

  IF Staining of HeLa using 25752-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using COX20 antibody (25752-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red).

• 

  IF Staining of PC-3 using 25752-1-AP

  Immunofluorescent analysis of PC-3 cells using 25752-1-AP (COX20 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

COX20 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 25752-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

FAM36A, Cytochrome c oxidase assembly protein COX20, mitochondrial, FAM 36A

---

Tested Applications

• Positive WB detected in: PC-3 cells
• Positive IHC detected in: human prostate cancer tissue, human endometrial cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells, PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 5 publications below
• IHC: See 1 publications below
• IF: See 2 publications below

Product Information

25752-1-AP targets COX20 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22520

  Product name: Recombinant human FAM36A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-118 aa of BC018519

  Sequence: MAAPPEPGEPEERKSLKLLGFLDVENTPCARHSILYGSLGSVVAGFGHFLFTSRIRRSCDVGVGGFILVTLGCWFHCRYNYAKQRIQERIAREEIKKKILYEGTHLDPERKHNGSSSN

• Full Name: family with sequence similarity 36, member A
• Calculated Molecular Weight: 118 aa, 13 kDa
• Observed Molecular Weight: ~16 kDa
• GenBank Accession Number: BC018519
• Gene Symbol: COX20
• Gene ID (NCBI): 116228
• RRID: AB_2880224
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5RI15
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

COX20, also name as FAM36A, belongs to the COX20 family. Mutations in COX20 are a novel cause of recessively inherited.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	Cell; Ribosome ADP-ribosylation inhibits translation and maintains proteostasis in cancers.; Authors - Sridevi Challa
mouse	WB	Sci Transl Med; NIT2 dampens BRD1 phase separation and restrains oxidative phosphorylation to enhance chemosensitivity in gastric cancer; Authors - Ziyang Wang
human	WB	Sci Adv; A dual role for PSIP1/LEDGF in T cell acute lymphoblastic leukemia; Authors - Lisa Demoen
mouse	WB,IF	Sci Data; Bioinformatic analysis of membrane and associated proteins in murine cardiomyocytes and human myocardium.; Authors - Shin-Haw Lee
human	WB,IHC	Front Endocrinol (Lausanne); Novel prognostic features and personalized treatment strategies for mitochondria-related genes in glioma patients; Authors - Ji Wu