Tested Applications
Positive WB detected in | PC-3 cells |
Positive IHC detected in | human prostate cancer tissue, human endometrial cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HeLa cells, PC-3 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 5 publications below |
IHC | See 1 publications below |
IF | See 2 publications below |
Product Information
25752-1-AP targets COX20 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag22520 Product name: Recombinant human FAM36A protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-118 aa of BC018519 Sequence: MAAPPEPGEPEERKSLKLLGFLDVENTPCARHSILYGSLGSVVAGFGHFLFTSRIRRSCDVGVGGFILVTLGCWFHCRYNYAKQRIQERIAREEIKKKILYEGTHLDPERKHNGSSSN Predict reactive species |
Full Name | family with sequence similarity 36, member A |
Calculated Molecular Weight | 118 aa, 13 kDa |
Observed Molecular Weight | ~16 kDa |
GenBank Accession Number | BC018519 |
Gene Symbol | COX20 |
Gene ID (NCBI) | 116228 |
RRID | AB_2880224 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q5RI15 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
COX20, also name as FAM36A, belongs to the COX20 family. Mutations in COX20 are a novel cause of recessively inherited.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for COX20 antibody 25752-1-AP | Download protocol |
IHC protocol for COX20 antibody 25752-1-AP | Download protocol |
IF protocol for COX20 antibody 25752-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Ribosome ADP-ribosylation inhibits translation and maintains proteostasis in cancers. | ||
Sci Transl Med NIT2 dampens BRD1 phase separation and restrains oxidative phosphorylation to enhance chemosensitivity in gastric cancer | ||
Sci Data Bioinformatic analysis of membrane and associated proteins in murine cardiomyocytes and human myocardium. | ||
Front Endocrinol (Lausanne) Novel prognostic features and personalized treatment strategies for mitochondria-related genes in glioma patients |