Product Information
83488-4-PBS targets FAM38B as part of a matched antibody pair:
MP00488-2: 83488-4-PBS capture and 83488-1-PBS detection (validated in Cytometric bead array)
MP00488-3: 83488-4-PBS capture and 83488-2-PBS detection (validated in Cytometric bead array)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag24528 Product name: Recombinant human FAM38B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 306-401 aa of AB527139 Sequence: KQKMIHELLDPNSSFSVVFSWSIQRNLSLGAKSEIATDKLSFPLKNITRKNIAKMIAGNSTESSKTPVTIEKIYPYYVKAPSDSNSKPIKQLLSEN Predict reactive species |
| Full Name | family with sequence similarity 38, member B |
| Calculated Molecular Weight | 318 kDa |
| Observed Molecular Weight | 250-310 kDa, 80 kDa |
| GenBank Accession Number | AB527139 |
| Gene Symbol | FAM38B |
| Gene ID (NCBI) | 63895 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9H5I5 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
FAM38B, also named as PIEZO2, is a mechanosensitive, rapidly inactivating (RI) ion channel which is open and converts the mechanical stimulus signals into bioelectrical signals after stimulated by mechanical signals. FAM38B has been recently identified in dorsal root ganglion (DRG) neurons to mediate tactile transduction. It plays an important role in the biological process, maintaining cell metabolism and cell migration. Loss-of-function mutations in the human FAM38B gene cause an autosomal recessive syndrome of muscular atrophy with perinatal respiratory distress, arthrogryposis, and scoliosis.The 80 kDa band detected by SDS-PAGE can be caused by alternative splicing (PMID: 34335288, 37227654).









