FAM38B Recombinant monoclonal antibody

FAM38B Uni-rAb® Recombinant Antibody for WB, FC (Intra), ELISA
Cat No. 83488-4-RR
Clone No.240406E5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), ELISA

Piezo2, 240406E5, C18orf30, Transmembrane protein C18orf30

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells
Positive FC (Intra) detected inA431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83488-4-RR targets FAM38B in WB, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag24528

Product name: Recombinant human FAM38B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 306-401 aa of AB527139

Sequence: KQKMIHELLDPNSSFSVVFSWSIQRNLSLGAKSEIATDKLSFPLKNITRKNIAKMIAGNSTESSKTPVTIEKIYPYYVKAPSDSNSKPIKQLLSEN

Predict reactive species
Full Name family with sequence similarity 38, member B
Calculated Molecular Weight 318 kDa
Observed Molecular Weight250-310 kDa, 80 kDa
GenBank Accession NumberAB527139
Gene Symbol FAM38B
Gene ID (NCBI) 63895
RRIDAB_3671114
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9H5I5
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FAM38B, also named as PIEZO2, is a mechanosensitive, rapidly inactivating (RI) ion channel which is open and converts the mechanical stimulus signals into bioelectrical signals after stimulated by mechanical signals. FAM38B has been recently identified in dorsal root ganglion (DRG) neurons to mediate tactile transduction. It plays an important role in the biological process, maintaining cell metabolism and cell migration. Loss-of-function mutations in the human FAM38B gene cause an autosomal recessive syndrome of muscular atrophy with perinatal respiratory distress, arthrogryposis, and scoliosis.The 80 kDa band detected by SDS-PAGE can be caused by alternative splicing (PMID: 34335288, 37227654).

Protocols

Product Specific Protocols
FC protocol for FAM38B antibody 83488-4-RRDownload protocol
WB protocol for FAM38B antibody 83488-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...