FASN Monoclonal antibody

• 

  WB analysis of HepG2 using 66591-1-Ig

  HepG2 cells were subjected to SDS PAGE followed by western blot with 66591-1-Ig (FASN antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 66591-1-Ig

  WB result of FASN antibody (66591-1-Ig; 1:800; incubated at room temperature for 1.5 hours) with sh-Control and sh-FASN transfected HeLa cells.

• 

  WB analysis of Jurkat using 66591-1-Ig

  Jurkat cells were subjected to SDS PAGE followed by western blot with 66591-1-Ig (FASN antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 66591-1-Ig

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 66591-1-Ig (FASN antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 66591-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66591-1-Ig (FASN antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 66591-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66591-1-Ig (FASN antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 66591-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using FASN antibody (66591-1-Ig, Clone: 1B6E4 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

FASN Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66591-1-Ig

Clone No.1B6E4

Publications(21)

Reviews (1)

Host / Isotype

Mouse / IgG1

Reactivity

human and More (2)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Type I fatty acid synthase, fatty acid synthase, FAS, 1B6E4

---

Tested Applications

• Positive WB detected in: HepG2 cells, HEK-293 cells, HeLa cells, Jurkat cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:20000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 18 publications below
• IHC: See 5 publications below
• IF: See 3 publications below
• IP: See 2 publications below

Product Information

66591-1-Ig targets FASN in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, monkey
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0975

  Product name: Recombinant human FASN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 142-439 aa of BC007909

  Sequence: QTQLNLRSLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGSPTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSSLAEPRVSVREG

• Full Name: fatty acid synthase
• Calculated Molecular Weight: 272 kDa
• Observed Molecular Weight: 272 kDa
• GenBank Accession Number: BC007909
• Gene Symbol: FASN
• Gene ID (NCBI): 2194
• RRID: AB_2881951
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P49327
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FASN gene codes for an enzyme essential for de novo fatty acid synthesis and cellular substrate energy metabolism. Active FASN is a homodimer in which each peptide subunit has a molecular weight of 260 kDa. FASN is overexpressed in various types of cancer including glioblastomas and is a potential therapeutic target. Recently FASN has been reported to contribute to the neurogenesis since FASN mutation caused intellectual disability in mice.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nature; Feeding induces cholesterol biosynthesis via the mTORC1-USP20-HMGCR axis.; Authors - Xiao-Yi Lu
		J Hepatol; OGDHL silencing promotes hepatocellular carcinoma by reprogramming glutamine metabolism.; Authors - Weiqi Dai
human	WB	Theranostics; Herb-sourced emodin inhibits angiogenesis of breast cancer by targeting VEGFA transcription.; Authors - Gengyi Zou
human	WB,IF,IP	J Transl Med; TC2N inhibits distant metastasis and stemness of breast cancer via blocking fatty acid synthesis; Authors - Xiang-Lin Hao
human	IHC,IP	Am J Cancer Res; Ubiquitin specific peptidase 38 promotes the progression of gastric cancer through upregulation of fatty acid synthase.; Authors - Zhi Zheng
human	WB	Environ Toxicol; SIRT1/mTOR pathway-mediated autophagy dysregulation promotes Pb-induced hepatic lipid accumulation in HepG2 cells; Authors - Yanan Zhao

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Sun (Verified Customer) (01-05-2023)

We detected a band around 200-300kDa region in HEK293T cells using this antibody.

• Applications: Western Blot
• Primary Antibody Dilution: 1:2000
• Cell Tissue Type: HEK293T