Tested Applications
| Positive WB detected in | HepG2 cells, HEK-293 cells, HeLa cells, Jurkat cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:20000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66591-1-Ig targets FASN in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, monkey, bovine |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0975 Product name: Recombinant human FASN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 142-439 aa of BC007909 Sequence: QTQLNLRSLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGSPTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSSLAEPRVSVREG Predict reactive species |
| Full Name | fatty acid synthase |
| Calculated Molecular Weight | 272 kDa |
| Observed Molecular Weight | 272 kDa |
| GenBank Accession Number | BC007909 |
| Gene Symbol | FASN |
| Gene ID (NCBI) | 2194 |
| RRID | AB_2881951 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P49327 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FASN gene codes for an enzyme essential for de novo fatty acid synthesis and cellular substrate energy metabolism. Active FASN is a homodimer in which each peptide subunit has a molecular weight of 260 kDa. FASN is overexpressed in various types of cancer including glioblastomas and is a potential therapeutic target. Recently FASN has been reported to contribute to the neurogenesis since FASN mutation caused intellectual disability in mice.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for FASN antibody 66591-1-Ig | Download protocol |
| IHC protocol for FASN antibody 66591-1-Ig | Download protocol |
| IP protocol for FASN antibody 66591-1-Ig | Download protocol |
| WB protocol for FASN antibody 66591-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-FASN (catalog #66591-1-Ig) has 41 total citations. Publications appear in journals including Nature, Molecular Cancer, Journal of Hepatology, Cell Discovery, Theranostics, Cell Death & Disease, International Journal of Biological Sciences, mBio, iScience, and Communications Biology. Research fields encompass lipid metabolism, fatty acid synthesis, hepatocellular carcinoma, NAFLD/MASH, obesity, metabolic syndrome, viral replication, osteoarthritis, and multiple cancer types including breast, lung, bladder, gastric, and cervical cancers.
| Species | Application | Title |
|---|---|---|
Mol Cancer ZDHHC20 mediated S-palmitoylation of fatty acid synthase (FASN) promotes hepatocarcinogenesis | ||
J Hepatol OGDHL silencing promotes hepatocellular carcinoma by reprogramming glutamine metabolism. | ||
Theranostics Herb-sourced emodin inhibits angiogenesis of breast cancer by targeting VEGFA transcription. |
Reviews
What customers say
One user (Sun A) rated this antibody 4/5 stars for Western Blot. They used a 1:2000 dilution (lot 10006833) on HEK293T cells and reported detecting a band in the 200–300 kDa region. Overall, the single review suggests the antibody works as expected for WB with a reasonable molecular weight band observed.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Sun (Verified Customer) (01-05-2023) | We detected a band around 200-300kDa region in HEK293T cells using this antibody.
|
