CoraLite®594-conjugated FASN Monoclonal antibody

• 

  IF Staining of HeLa using CL594-66591

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CoraLite®594 FASN antibody (CL594-66591, Clone: 1B6E4 ) at dilution of 1:200.

FASN Monoclonal Antibody for IF/ICC

Cat No. CL594-66591

Clone No.1B6E4

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

IF/ICC

Synonyms

FAS, FASN, fatty acid synthase, OA 519, SDR27X1

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66591 targets FASN in IF/ICC applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0975

  Product name: Recombinant human FASN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 142-439 aa of BC007909

  Sequence: QTQLNLRSLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGSPTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSSLAEPRVSVREG

• Full Name: fatty acid synthase
• Calculated Molecular Weight: 272 kDa
• Observed Molecular Weight: 272 kDa
• GenBank Accession Number: BC007909
• Gene Symbol: FASN
• Gene ID (NCBI): 2194
• RRID: AB_2920012
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P49327
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

FASN gene codes for an enzyme essential for de novo fatty acid synthesis and cellular substrate energy metabolism. Active FASN is a homodimer in which each peptide subunit has a molecular weight of 260 kDa. FASN is overexpressed in various types of cancer including glioblastomas and is a potential therapeutic target. Recently FASN has been reported to contribute to the neurogenesis since FASN mutation caused intellectual disability in mice.