• Featured Product
  • KD/KO Validated

FASN Monoclonal antibody, PBS Only (Detector)

FASN Monoclonal Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 66591-1-PBS
Clone No.1B6E4

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

1B6E4, FAS, fatty acid synthase, Type I fatty acid synthase

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66591-1-PBS targets FASN as part of a matched antibody pair:

MP51570-1: 66591-2-PBS capture and 66591-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0975

Product name: Recombinant human FASN protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 142-439 aa of BC007909

Sequence: QTQLNLRSLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGSPTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSSLAEPRVSVREG

Predict reactive species
Full Name fatty acid synthase
Calculated Molecular Weight 272 kDa
Observed Molecular Weight 272 kDa
GenBank Accession NumberBC007909
Gene Symbol FASN
Gene ID (NCBI) 2194
RRIDAB_2881951
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP49327
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

FASN gene codes for an enzyme essential for de novo fatty acid synthesis and cellular substrate energy metabolism. Active FASN is a homodimer in which each peptide subunit has a molecular weight of 260 kDa. FASN is overexpressed in various types of cancer including glioblastomas and is a potential therapeutic target. Recently FASN has been reported to contribute to the neurogenesis since FASN mutation caused intellectual disability in mice.

Loading...
||
New chat Able
正在加载,请稍候...