FASN Monoclonal antibody, PBS Only

• 

  WB analysis of HeLa using 66591-1-Ig (same clone as 66591-1-PBS)

  WB result of FASN antibody (66591-1-Ig; 1:800; incubated at room temperature for 1.5 hours) with sh-Control and sh-FASN transfected HeLa cells. This data was developed using the same antibody clone with 66591-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 66591-1-Ig (same clone as 66591-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 66591-1-Ig (FASN antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66591-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 66591-1-Ig (same clone as 66591-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 66591-1-Ig (FASN antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66591-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 66591-1-Ig (same clone as 66591-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 66591-1-Ig (FASN antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66591-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 66591-1-Ig (same clone as 66591-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66591-1-Ig (FASN antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66591-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 66591-1-Ig (same clone as 66591-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66591-1-Ig (FASN antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66591-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 66591-1-Ig (same clone as 66591-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using FASN antibody (66591-1-Ig, Clone: 1B6E4 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 66591-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

FASN Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 66591-1-PBS

Clone No.1B6E4

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Type I fatty acid synthase, fatty acid synthase, FAS, 1B6E4

---

Product Information

66591-1-PBS targets FASN in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0975

  Product name: Recombinant human FASN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 142-439 aa of BC007909

  Sequence: QTQLNLRSLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGSPTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSSLAEPRVSVREG

• Full Name: fatty acid synthase
• Calculated Molecular Weight: 272 kDa
• Observed Molecular Weight: 272 kDa
• GenBank Accession Number: BC007909
• Gene Symbol: FASN
• Gene ID (NCBI): 2194
• RRID: AB_2881951
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P49327
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FASN gene codes for an enzyme essential for de novo fatty acid synthesis and cellular substrate energy metabolism. Active FASN is a homodimer in which each peptide subunit has a molecular weight of 260 kDa. FASN is overexpressed in various types of cancer including glioblastomas and is a potential therapeutic target. Recently FASN has been reported to contribute to the neurogenesis since FASN mutation caused intellectual disability in mice.